KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_01709Help
Entry
PXO_01709         CDS       T00763                                 

Definition
(GenBank) fatty oxidation complex alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop00071  Fatty acid degradation
xop00280  Valine, leucine and isoleucine degradation
xop00281  Geraniol degradation
xop00310  Lysine degradation
xop00362  Benzoate degradation
xop00380  Tryptophan metabolism
xop00410  beta-Alanine metabolism
xop00640  Propanoate metabolism
xop00650  Butanoate metabolism
xop00903  Limonene and pinene degradation
xop00930  Caprolactam degradation
xop01040  Biosynthesis of unsaturated fatty acids
xop01100  Metabolic pathways
xop01110  Biosynthesis of secondary metabolites
xop01120  Microbial metabolism in diverse environments
xop01130  Biosynthesis of antibiotics
xop01200  Carbon metabolism
xop01212  Fatty acid metabolism
Module
xop_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PXO_01709
   00650 Butanoate metabolism
    PXO_01709
  Lipid metabolism
   00071 Fatty acid degradation
    PXO_01709
   01040 Biosynthesis of unsaturated fatty acids
    PXO_01709
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PXO_01709
   00310 Lysine degradation
    PXO_01709
   00380 Tryptophan metabolism
    PXO_01709
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PXO_01709
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PXO_01709
   00281 Geraniol degradation
    PXO_01709
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PXO_01709
   00930 Caprolactam degradation
    PXO_01709
Enzymes [BR:xop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PXO_01709
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PXO_01709
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PXO_01709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_binding_2 ApbA Pyr_redox_2 AlaDh_PNT_C MORN UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ACD59686
UniProt: A0A0K0GLQ1
Position
3173291..3175372
Genome map
AA seq 693 aa AA seqDB search
MLPGFDGLRFSHWQAELREDGVVVLSLDRQDAPVNAFSQEVLLELGALVERLALEPPKGV
VLRSGKANGFIAGADLKEFQQFDHKGTVNDAIHRGQQVFQKLAELPCPTVAAIHGFCMGG
GTEIALACRYRVASDDGSTRIGLPETKLGIFPGWGGSARLPRLIGAPAAMDLMLSGRTVS
AKAARAMGLVDKVAAPAVLVDAAAALALAGTTRPFQQRATAWATNTLLARKILAPQMRKQ
VARKARKEHYPAPYALITVWERAGGSGIQARLAAERKAVVKLASTPTARNLIRIFFLTER
LKALGGKDAAGAAATPIRHVHVIGAGVMGGDIAAWAAYKGFDVTLQDREQRFIETALTRG
GELFAKRVKDDAKRPAVAARLRGDLAGAGVTQADLVIEAIIENPQAKRDLYQSIEPQLKP
DALLTTNTSSIPLTELRGHIQRPAQFAGLHYFNPVAMMPLVEIVQHDGLDPANVARLAAF
CKALDKFPVPVAGTPGFLVNRVLFPYLLEAATAYAEGIPGPVLDKTAVKFGMPMGPIELI
DTVGLDVAAGVGAELAPFLHLPIPAALITVEAGKRGKKDGQGLYTWENGRAVKPEVASGY
IAPADLEDRLILPLLNEAVACLHDGVVADADLLDAGVIFGTGFAPFRGGPIQHIRSVGAD
ALLERLQALHARYGERFAPRPGWDSPVLREAVV
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgcttccaggtttcgacgggctccgattcagccattggcaggccgagctgcgcgaggac
ggcgtggtcgtgctcagcctcgatcgccaggacgcaccggtcaacgcattttcccaggag
gtgctgctggagttgggcgcactggtcgagcgcctggcactggagccgcccaagggcgtg
gtgctgcgctcgggcaaagccaacggtttcatcgccggtgccgatctgaaagaatttcag
caattcgaccacaagggcacggtcaacgatgcgattcatcgcgggcagcaggtctttcag
aagctggccgaactgccctgcccgaccgttgcggcgattcatggcttctgcatgggcggc
ggcaccgaaatcgcgctggcatgccgctaccgcgtggcctccgacgatggcagtacgcgc
atcgggttgccggaaaccaagctcggcatcttccccggctggggcggcagcgcccgcttg
ccgcgcctgatcggtgcgccggcggcgatggacctgatgctcagcggccgcaccgtgtcg
gccaaggctgcgcgcgcaatgggtctggtcgacaaggtcgccgcacctgcggtgctggtc
gatgcggctgcggcactggcgctcgcgggtacgacgcgtccgttccagcagcgcgccact
gcgtgggccaccaacaccttgctggcgcgcaaaatactggcgccgcagatgcgcaaacaa
gtggcccgcaaggcgcgcaaggagcattaccctgcgccatacgcgttgatcacggtgtgg
gagcgggctggcggcagcggcatccaggcccgcctggcggccgagcgcaaggcagtggtc
aagctcgccagcacgccgaccgcacgcaacctgatccgcatcttcttcctgaccgagcgt
ttgaaggcgctgggcggcaaggatgcagccggcgcggcagcgacgccgatccgccatgtg
cacgtcatcggcgctggcgtgatgggcggcgacatcgcggcgtgggcggcctacaagggc
ttcgacgtcacattgcaggaccgcgagcagcgttttatcgagacggcgctgacgcgcggc
ggcgaactgttcgccaagcgcgtcaaagacgacgccaagcggccggccgtggccgcgcgt
ctgcgcggtgacctggccggtgcgggtgtgacgcaggccgatctggtgatcgaggcgatc
atcgaaaacccgcaggccaagcgcgatctgtatcaatcgatcgagccgcagctcaagccg
gatgcattgctgaccaccaatacatcttcgattccgctgaccgaactgcgtggccacatc
cagcgcccggcgcagttcgccggcctgcactatttcaacccggtggcgatgatgccgctg
gtggaaatcgtgcagcacgatggcctggatcccgccaacgtggcgcgcctggctgcattc
tgcaaggcactggacaagttcccggtgccggtggccggcacgccggggttcctggtcaac
cgggtgctgttcccgtacctgcttgaagcggccaccgcgtatgcggaaggcatacccggc
ccggtgctggacaagacggcggtgaaattcggcatgccgatggggccgatcgagttgatc
gacaccgtgggtctggacgtcgccgccggcgtgggcgcggagttggcgccgttcctgcac
ctaccgattccggcagcgctgatcacggtggaagccggcaagcgcggcaagaaggacggc
cagggcttgtacacgtgggagaatgggcgtgcggtcaaaccggaggttgccagtggctac
atcgcaccggcagatctggaagaccggctgattctgccgctgctcaacgaagcggtggcg
tgtctgcacgacggcgtggtggccgacgcagacctgctcgatgccggcgtcatcttcggc
accggctttgcgcccttccgcggtggcccgatccagcacatccgcagcgtcggcgcagat
gcgctgctggaacgtttgcaggcgctgcacgcacgttatggcgaacgtttcgcaccgcgc
ccgggttgggactcgccggtgttgcgggaggcggtggtgtaa

DBGET integrated database retrieval system