KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_02029
Entry
PXO_02029         CDS       T00763                                 

Definition
(GenBank) Rhs element Vgr protein
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
SSDB
Motif
Pfam: Phage_GPD T6SS_Vgr DUF2345 Phage_base_V
Other DBs
NCBI-ProteinID: ACD60348
UniProt: A0A0K0GNK7
Position
complement(3887478..3890264)
AA seq 928 aa
MLSDSGRLYRLQLPGGDVQVVERWSGSERLSGGFEWWVDVLSTQAGLPLEAWLGRRATLY
TRLADGDESPRTGLIHDAYVLGSDGGLARYRVGLVPWTWWLSQGRHSRVFQERTLVQIVE
AVCADYAPMASWQWSEETSAFLAQARPRSYCVQYRESDLDFVQRLLAEEGLGWRLQEADA
SPGGHQLVVFADSAAQPQDPSSAQGGGLRYHRSDATEAADSVLAIGATRRLGSGRLTVLS
EDFKTRQARSAQLPLHGGGRQSLREVYEPVGMDAFASAQAADRSAELMAQAHEAQWSPWQ
GRSTVRTLRAGTWFTLTQAPQQGQAPPAQLLLTRVWHAGINNLPVDVRAAVQSQLGAAPA
WPDASAVAARSTWAQAEAVGYGNAFEAVDRQQPWRPVLADGTGARLHPRPTAPGYQSAIV
VGADGSTDGSQEVHADALGRIRVRFHFQHAASAPAAQDSTWLRVAQRYAGPGVGSQFLPR
IGQEVLVGFLEGDIDRPVVLGALYNGKGEAGVPATPGGTSAEADTGLYAQAGDGRPSAQG
NLAGGHAPAWHGAGGGADNHRNATALWGVQSKEWGGAGHSRLVFDDSDQQLRLQLATTQA
ATQLNLGHLIHQADNYRGSFRGEGFELRTDAWGAVRASSGLWLSSYGRSGGPAGEATQPS
ALLSQLQTLGKTFSQAAGTHQTVKLAAHEGVGQANHSQLIAEQAPLPALLTSVKTTVPGT
AYADAKGAAAERSASPGDDRVPHTGDALLGLAAPAGIGVVAGQGLSWSVGETLTLASGAG
SEAAIAGDARLHSGQAIGVLAAAVDGGQTQANSLSLVSGEGALDVQAQSDEVRVQSKEGL
KLISANADVALAAGKTLHLAVAGGASVTIEAGNITVACPGTITVHASKKSFVGPVQQAYP
LPAFAKSVCIPCLLQAMGKGQALSPVNG
NT seq 2787 nt   +upstreamnt  +downstreamnt
ttgctgtccgacagcggccgcctataccgcttgcagctgcctggcggggatgtccaggtg
gtggagcgctggagcgggtcggaacggctgagcggcggttttgagtggtgggtggacgtg
ctgagcacgcaggcgggcttgccgctggaggcgtggctggggcggcgcgcgacgctgtac
acccggctggccgatggcgatgaaagcccgcgcacggggttgatccacgacgcgtacgta
ctgggcagcgatggcgggctggcgcgctaccgggtaggcctggtgccgtggacgtggtgg
ttgtcgcagggccggcacagccgggtattccaggaacgcacgctggtgcagatcgtggaa
gcggtgtgcgccgactacgcgccgatggcaagctggcagtggagcgaggagacgagcgcg
ttcctggcccaggcgcggccgcgcagctactgcgtgcagtaccgcgagagcgacctggat
ttcgtgcagcggctgctggccgaggaaggcctgggctggcggctgcaggaggcggacgcg
tcgcccggcgggcaccagctggtggtgttcgccgacagcgccgcgcaaccgcaggacccc
agttcggcgcagggcggggggctgcgctaccaccgcagcgacgccaccgaggcggccgac
agcgtgctggcgatcggcgccacccggcggctgggcagcggccggctgacggtgctcagc
gaggacttcaagacgcgccaggcgcgcagcgcgcagttgccgttgcacggcggcggcagg
cagtcgctgcgcgaggtgtacgagccggtggggatggatgccttcgccagcgcgcaggca
gcagaccgctctgcggagttgatggcgcaggcgcacgaggcgcagtggtcaccgtggcag
ggccgcagcacggtgcgcacgctgcgcgccggcacctggttcacgctgacccaggcaccg
cagcagggccaggcgccgccggcgcagctgttgctgacgcgggtgtggcatgcgggtatc
aacaacttgccggtggacgtgcgcgcggcggtgcagtcgcagttgggggccgcgccggcg
tggccggacgccagcgcggtggccgcacgcagcacctgggcgcaggccgaggcggtgggc
tacggcaacgccttcgaggcggtggaccggcagcagccgtggcggccggtcctggccgac
ggcaccggggcgcggctgcacccgcggccgaccgcgccgggctaccagagcgccatcgtg
gtcggtgccgatggcagcaccgacggcagccaggaggtccatgccgacgcgctgggccgg
atccgggtcaggtttcacttccagcacgccgcgtcggccccggccgcgcaggacagcacg
tggctgcgggtggcgcagcgctacgccggcccgggcgtgggcagccagttcctgccgcgc
atcggccaggaagtgctggtgggcttcctggagggggacatcgaccgtccggtggtgctg
ggggcgctgtacaacggcaagggcgaagccggcgttcctgccacccccggcggcaccagc
gccgaggccgacaccggcctgtacgcccaggccggcgacggcagacccagcgcgcagggc
aacctggccggcggccatgccccggcctggcacggcgccggcggcggcgcggacaaccac
cgcaacgccaccgcgctgtggggcgtgcaatccaaggaatggggcggcgctggccacagc
cggctggtgttcgacgacagcgaccagcaactgcgcttgcaacttgcgaccacccaggca
gccacgcaactgaacctggggcacctgatccaccaggccgacaactaccgcggcagcttc
cgcggggaaggcttcgaactgcgcaccgacgcgtggggcgcggtgcgtgccagctcgggg
ctatggctgagcagctacggccgcagcggcggcccggccggcgaggcgacccagcccagc
gcattgctgagccagctgcagacgctgggcaagacgttctcgcaggcggcgggcacgcac
cagacggtgaagctggccgcgcacgaaggcgtgggccaggcgaaccactcccagctgatc
gccgagcaggcgccgctgccggcgctgctgaccagcgtgaagaccacggtgccgggcacg
gcctacgccgacgccaagggcgcggcggccgagcgcagcgccagcccgggcgatgaccgg
gtgccgcacaccggcgatgcgctgctgggcctggccgcaccagcggggatcggcgtggtg
gccggccagggcctgagctggagcgtgggcgagacgctgacgctggccagcggcgcgggc
agcgaagcggccatcgccggcgacgcccggctgcacagcggccaggcaatcggcgtgctg
gccgcggcggtggacggcgggcaaacgcaagccaacagcctgagcctcgtcagcggcgaa
ggcgcgctggacgtgcaggcgcagtcggacgaagtacgggtgcagtcgaaagaaggactg
aagctgatcagcgccaacgccgacgtggcactggcggcgggcaagaccctccacctggcg
gtggccggcggggccagcgtgaccatcgaagccggcaacatcaccgtcgcctgccccggc
accatcaccgtgcatgcgagcaagaagtcgtttgtggggccggtgcagcaggcgtatccg
ttgcccgcgttcgcaaagtcggtctgcatcccgtgcctgttgcaggccatgggcaagggg
caagcgttgtccccggtgaatgggtga

DBGET integrated database retrieval system