KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_02036Help
Entry
PXO_02036         CDS       T00763                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:xop00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PXO_02036
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xop02044]
    PXO_02036
Secretion system [BR:xop02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PXO_02036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_Vgr DUF2345 Phage_GPD DUF4178
Motif
Other DBs
NCBI-ProteinID: ACD60341
UniProt: A0A0K0GN71
Position
3880111..3881874
Genome map
AA seq 587 aa AA seqDB search
MSATLVIFDPQAQVPDSGTIRFHRSDLAEADDAIGAFGERRGVVPTASTVTSWHSEQVRA
VGAQAQAQAEAGALPPLEVYVQPRAGRFAQEATAQDQAQARLDALRVPHTLHAGAGSARV
LAAGAAFTLRQHAQHDGQRFVPVAIEHVAVNNLGQGIVALLDAPELEHGSYRNRFLAVPA
ATPLRALPQDRPRMPGPQSARVVGVADAALSPSRDHQVRIQFPWQRGDQPAPGGLTDSAS
TAPGHAPGDQRAGTWVPVAEWVAGPNWGSHFLPRIGSEVLVEFLHGDIDQPRITGQLYNG
EVAPPFGGGLDARASHPGTLSGLHTQSHDGSGTQQWLLDDTPGQLRTRLHTSLADTRLEL
GYLVQHSDTARGALRGQGFELASQGWGNVHAAQGLLLSSSARDQGASTALDAAEAVAQLH
GAQRTAQALHATLTQQQVPGLDAHPSVTRLREAIDPQAQGKYTAAVGGQAATTPADGGRD
GQAPVERFAQARLLGESPDHIAWTTPASAVAYAGQALQLTVQQDAQLSAGQTLSAVSGQH
TALFAQRGPIKLIAAAGPVSLQAHTGALELLADQAVTVTATDTRASC
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggccacgctggtgatcttcgacccgcaggcgcaggtgccggacagcggcacgatc
cgcttccaccgcagcgacctggccgaggccgacgatgcgatcggcgccttcggcgagcgc
cgcggcgtcgtgcccaccgccagcacggtgaccagctggcacagcgagcaagtgcgcgcg
gtcggcgcgcaggcccaggcccaggccgaggccggcgcgctgccgccgctggaggtctac
gtgcagccgcgcgccgggcgtttcgcccaggaggcgaccgcgcaggatcaggcgcaggcg
cggctggacgcgctgcgcgtgccgcacacgctgcacgccggggccggcagcgcccgcgtg
ctggcggccggggcggcgttcaccttgcgccagcacgcccagcacgacggccagcgtttc
gttccggtggcgatcgagcacgtggcggtgaacaacctgggccagggcatcgtcgccctg
ctggacgcgccggagctggagcacggcagctaccgcaaccgcttcctggcggtgccggcg
gccacgccgctgcgcgcgctgccgcaggaccgcccgcgcatgcccgggccgcagagcgcg
cgcgtggtcggcgtggccgacgcggcgctgagcccgagccgcgaccaccaggtgcggatc
cagttcccgtggcagcgcggcgaccagcccgccccgggcgggttgaccgacagcgccagc
accgcgcccggccacgcgccgggcgaccagcgcgccggcacctgggtgccggtggccgag
tgggtggccggcccgaactggggcagccacttcctgccgcgcatcggcagcgaagtgctg
gtggagttcctgcacggggacatcgatcagccgcgcatcaccggccagttgtacaacggc
gaggtcgccccacccttcggcggcggcctggacgcgcgtgccagccaccccggcacgctc
agcggcctgcacacccagtcccacgacggcagcggcacccagcaatggctgctggacgac
acccccggccagctgcgcacgcgcctgcacacctcgctggccgacacccggctggaactg
ggctacctggtccagcacagcgacaccgcccgcggcgcgctgcgcggccagggcttcgaa
ctggcctcccagggctggggcaacgtgcatgccgcgcaaggcctgctgctgtccagcagc
gcccgcgaccagggggcctcgaccgcattggacgcggccgaggcggtggcccagttgcac
ggcgcccaacgcaccgctcaggcgctgcacgccaccctgacccagcaacaggtgcccggc
ctggacgcccatcccagcgtgacccggctgcgcgaggccatcgacccgcaagcgcagggc
aagtacaccgctgcggtcggcggccaggcagcgaccacgccggccgacggcggccgcgac
ggccaggcaccggtggaacgcttcgcccaggcgcgcctgctcggcgagtcgccggaccac
atcgcctggaccaccccggccagcgcggtggcctatgccgggcaggccctgcagttgacc
gtgcagcaggatgcgcagctgagcgccgggcagaccctgtcggcggtgtccggccagcac
accgcgctgttcgcccaacgcgggccgatcaaactcatcgccgccgccggcccggtgagc
ctgcaggcacataccggcgcgctggaactgctggccgaccaggcggtgaccgtcaccgcc
accgacacccgcgctagctgttga

DBGET integrated database retrieval system