KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_02041Help
Entry
PXO_02041         CDS       T00763                                 

Definition
(GenBank) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:xop00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PXO_02041
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xop02044]
    PXO_02041
Secretion system [BR:xop02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PXO_02041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU
Motif
Other DBs
NCBI-ProteinID: ACD60336
UniProt: A0A0K0GN66
Position
3868761..3869549
Genome map
AA seq 262 aa AA seqDB search
MNPLPPTPGPMPSLTAQAPHGLPSAHTSTPQSLLDLMADGFYLLLLLKRTQMPSDTESFV
QSVQTFLDGVERGAVKLGIASEDIYAAKYAFCAAVDEAILSQPSALHETWERNPLQLRLF
GEHLAGEHFFDRLEELRRQGAVRLPSLEIYHYCLLLGFEGKYRLEGPEKLGYLTARLGDE
IIYFKGKRSGFAPHWPPPDNVRHALRRVVPLWLPAALVTGFGLLGFFGLRLSLDHQTERR
MAAYNQVVQMPQRTAHITITLP
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgctgccccccacccccggcccgatgccgtcgctgaccgcgcaggcaccgcac
ggcctgccgagcgcccatacctccacgccgcagagcctgctcgacctgatggccgacggc
ttctacctgttgctgctgctcaagcgcacgcagatgcccagcgacaccgaatccttcgtg
cagtcggtgcagacattcctcgatggcgtggaacgcggcgcagtcaagctcggcatcgcc
tccgaggacatctacgcggccaaatacgcgttctgcgcggcagtagacgaagcgatcctg
tcgcagccctcggcactgcacgaaacctgggaacgcaatccgctgcagctgcgcctgttc
ggcgaacacctggccggcgagcatttcttcgatcgcctggaagagctgcgccgccagggc
gccgtgcgcctgccctcgctggagatctaccactattgcctgctgcttggcttcgaaggc
aagtatcggctggaagggccggaaaagctcggctacctgaccgcgcggctgggcgacgag
atcatctatttcaagggcaagcgcagcggtttcgcaccgcattggccgccgccggacaac
gtgcgccatgccttgcgccgtgtggtgccgctgtggctgccggccgcgctggtgaccggc
ttcggcctgctcggcttcttcggtctgcgcctgtctctggaccaccagaccgagcggcgc
atggccgcctacaaccaggtggtgcagatgccgcaacgcaccgcgcacattacgatcacc
ctgccgtga

DBGET integrated database retrieval system