KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_02292Help
Entry
PXO_02292         CDS       T00763                                 

Definition
(GenBank) hydrolase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop00010  Glycolysis / Gluconeogenesis
xop01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PXO_02292
Enzymes [BR:xop01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     PXO_02292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Hint HEAT_EZ
Motif
Other DBs
NCBI-ProteinID: ACD60586
UniProt: A0A0K0GNU7
Position
4138826..4139443
Genome map
AA seq 205 aa AA seqDB search
MSPTPPSLLLLDFDGVLAQSARPRCMAALAAAAGCSPQRVHDVVFAQGLERAYDAGQIDT
QTYLAQLSEELGHPIDRATWIAARVAACRADPSAVAQVLAVSATTAVAVLTNNGTLMVDA
IEQIVPSLFPLLQDRVLCSGALGGRKPEVQVYRRALAQLGQRAEHTLFVDDLFVNVRGAR
TAGLHADTVRDARALRRVLKRYGLA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcctacaccaccgtcgctgctgttgctcgatttcgacggtgtgctcgcgcagtcc
gcgcggccacggtgcatggccgcccttgccgcggcggcgggctgctcaccgcagcgggtg
catgacgtggtgttcgcgcaaggtctggaacgcgcctacgatgccggtcagatcgacacg
cagacgtatctggcgcagttgagcgaagaactggggcacccgatcgatcgcgccacctgg
atcgcggcacgcgttgctgcatgccgcgccgatccttcggcagtggcacaggtgctggcg
gtctcggcgaccacggctgtggcggtgctcaccaataacggcacgctgatggtggacgcg
atcgagcagatcgtgccgtcgttgtttccgttattgcaggaccgcgtgctctgcagcggc
gcgctcggcggccgcaaacccgaggtgcaggtgtatcggcgcgcgctggcgcaactgggg
caacgcgccgagcacacgctgttcgtcgacgacttgttcgtcaacgtgcgcggcgcacgc
acggccggtctgcacgccgacaccgtgcgcgacgcgcgcgcattgcggcgggtgctgaag
cgctacggacttgcatga

DBGET integrated database retrieval system