KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_02589Help
Entry
PXO_02589         CDS       T00763                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop00010  Glycolysis / Gluconeogenesis
xop00030  Pentose phosphate pathway
xop00051  Fructose and mannose metabolism
xop00052  Galactose metabolism
xop00680  Methane metabolism
xop01100  Metabolic pathways
xop01110  Biosynthesis of secondary metabolites
xop01120  Microbial metabolism in diverse environments
xop01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PXO_02589
   00030 Pentose phosphate pathway
    PXO_02589
   00051 Fructose and mannose metabolism
    PXO_02589
   00052 Galactose metabolism
    PXO_02589
  Energy metabolism
   00680 Methane metabolism
    PXO_02589
Enzymes [BR:xop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PXO_02589
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     PXO_02589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ACD60874
UniProt: A0A0K0GP49
Position
4433669..4434925
Genome map
AA seq 418 aa AA seqDB search
MTTGNVLYAQSGGVTAVINATAAGVIAEARARKIKVLAARNGILGALREDLIDTSKESAA
AIAALAQTPGGAFGSCRYKLKSLEEDSAKYERLLDVLRAHDVRWFLYNGGNDSADTAWKV
SQLAKAYGYPLHCIGVPKTIDNDLAVTDTCPGFGSAAKYTAVSVREAALDVAAMADTSTK
VFIYEAMGRHAGWLAAAAGLAGQGPDDAPQIILLPERAYDQTAFLAKVKQVVDKVGWCVV
VASEGIQNAHGKFVADAGGAADSFGHAQLGGVAAFLAAQVKQELGYKVHWTLPDYLQRSA
RHLASKTDWEQAQAVGKAAVQYALKGMNAVIPVIERVSDTPYRWKIVPAPLHKVANHEKK
MPPSFLRKDGFGITERARRYFAPLIKGEAPLAYGSDGLPTYVTLKNVAVAKKLPAWEG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaccactggcaacgtgttgtatgcccaatccggcggcgttaccgccgtcatcaacgcc
accgccgccggtgtcatcgccgaagcgcgcgcacgcaagatcaaggtactggctgcacgc
aacggcatcctgggcgccttgcgcgaggacttgatcgacacatccaaagaatccgccgca
gccattgccgcattggcgcagacacccggcggcgcgttcggctcgtgccgctacaagctc
aaatcgttggaagaggacagcgccaagtacgagcgcctgctcgatgtgctgcgcgcgcac
gatgtgcgctggtttctctacaacggcggcaatgattcggccgacaccgcgtggaaggtc
tcgcaactcgcaaaagcctatggctacccactgcactgcatcggcgtacccaagaccatc
gataacgacctggcggtgaccgacacctgccccggcttcggctcggcggccaagtacacc
gccgtctcggtccgcgaggccgccttggacgtcgccgccatggccgacacctccaccaag
gtcttcatctatgaagccatgggccgccacgccggctggctggccgcagccgcaggcctt
gccgggcagggccccgacgacgcaccgcagatcatcctgctgcccgaacgcgcctacgac
cagaccgcgtttctggcaaaggtaaagcaggtagtggacaaagtcggctggtgcgtcgtg
gtagccagcgaaggcatccagaacgcgcacggcaagttcgtcgccgatgccggcggcgcg
gcggattccttcggccacgcgcagctcggcggcgtggccgcgttcctggccgcacaggtc
aagcaggaactcggctacaaggtgcactggaccttgcccgattacctgcaacgctccgca
cgccacctcgcatcgaagaccgactgggaacaggcccaagccgtcggcaaggccgccgtg
cagtacgccctcaagggcatgaacgcggtgatcccggtgatcgaacgcgtcagcgacacc
ccctaccgctggaagatcgtacccgcgcccctgcacaaggtggccaaccacgaaaagaaa
atgccgcccagtttcctgcgcaaggacggcttcggcatcaccgagcgcgcccgccgctac
ttcgccccgttgatcaaaggcgaagcgccgctggcctacggcagcgatggtttgccgacg
tatgtgacgttgaagaatgtggcggtggcgaagaagttgccggcgtgggaggggtga

DBGET integrated database retrieval system