KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03553Help
Entry
PXO_03553         CDS       T00763                                 

Definition
(GenBank) RecF/RecN/SMC N terminal domain protein
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_23 AAA_21 SMC_N ABC_tran Dynactin_p22 AAA_29 AAA_15
Motif
Other DBs
NCBI-ProteinID: ACD56970
UniProt: A0A0K0GFW0
Position
complement(321509..324163)
Genome map
AA seq 884 aa AA seqDB search
MSDQYTYARFWRCALQVNPVGYKGTYRGADHGLDEAGYNQALLQKCLELGITVVGLADHG
SVASVDALRQVLQPHGIVVFPGFEIASNDKTHYVCLFPEDTTLQHLDRYLGNLKLLDPAD
GIRPSRLSSEELIEEIDRVGGFIYGAHCTQESGLLKNRLNHVWKHPKLRAAQIPGSIDDL
TSVEGDFYRKVFLNKDDSYRRERPVAAINAKDVAKPDDLEHPGATCFIKMTRPNFAAFKV
AFLDPGSRIRLNSQQAQGPIGKVVRMTVAGGYLDGVRVDFSDHLNTVIGGRGTGKSTLLE
CLRFALDLPPKGKQAQKLHQEITKENLGRSAGRVELTVVSSAQNGKQYTISRRHGEPPMV
RDMDGNVSTLLPRDLLPGIDIYGQNEIYELAQDETSRVQLLDRFLPQDGEYEAKRADVHR
RLKDNQQKLTKSLTNLDDLNSQVERLPKLEEQLRGFDELGIKEKLAKTSLLAREREIAKT
ATDGVQSLRDALSDLRDSLPDLDFINDEALEGLPDAAQLLAMRTTLDGLKQGFTGHLTAM
QALLDDKAGQFTTQHDVWQQAIQAHDVGLEKALRTLPATAGKSGQEVGVAYQKLLGEIER
IKPMKSRATTHQSQRDTLRQERRNLLTELSDLRGQRIQALQKAAKQLNRRLEGKLKVEIV
PEADRTPLMTFLLGCKLDGVGEKRLAFIEDAETISPLSLAQSIQKASADVQLDWGVTQMV
ADALTKLQSSQLMELEALELEHRADISLNVAHAQADAVFRPLNKLSTGQQCTAILHMLLL
ENVDPLLMDQPEDNLDNAFIADRIVAELREAKTSRQFLFATHNANIPVFGDAEWIGVFTA
AENQGCLGLEAQGSIDVPVIRDQVARLLEGGRDAFIQRKEKYEF
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccagtacacctacgcgagattctggcgctgtgcgttacaggtcaatccggtc
ggctacaaaggcacctacaggggggccgaccacggccttgacgaagccggctacaaccaa
gccttgcttcaaaagtgccttgagttgggcatcacggttgtgggccttgctgaccacggc
agtgtggccagcgttgatgccttgcgtcaggtgttgcagccgcacgggatcgtggtgttt
cccggcttcgagatcgcttcaaacgacaagactcactacgtctgcctcttccccgaggac
acgacgttgcagcaccttgatcgctaccttggaaacctcaagctgcttgatccagcagac
ggcatccggccttctcgcctgagttctgaagagctgatcgaagagatcgatcgagttggc
gggttcatctacggcgcacattgcacacaggagagcgggctgctcaaaaaccgcctgaac
cacgtatggaagcatcccaagctgcgcgcggcccagattccggggtcgatagatgacctt
acgagtgtcgagggtgacttctaccgcaaggtgtttttgaacaaggacgatagctaccgg
cgtgagcgccccgtggcggcgatcaacgccaaggatgttgccaagcctgatgacttggag
cacccgggggcaacttgtttcatcaagatgacgcggccaaactttgccgcgttcaaagtt
gccttcctcgatccgggatcgcgaattcgcctcaactctcagcaggcccaaggcccgatt
ggcaaggttgtgcgcatgaccgttgcgggcggctaccttgatggcgtccgggtggatttt
tctgaccacctcaacaccgtgatcggcggccgtgggacgggcaagtcaaccttgctcgaa
tgcttacgcttcgccttggacttgccacccaaaggcaaacaggctcagaagctccatcaa
gagatcaccaaggagaaccttggtcgttcggccggtcgggttgagctgaccgtggtgtcc
tctgcccagaacggcaagcagtacaccatctcgcgccgtcatggcgagccgccgatggtg
cgtgacatggatggcaatgtctccaccctgctcccgcgcgacttgcttccgggcatcgac
atttatgggcagaacgagatttacgagctggcccaagatgaaaccagccgggtgcagttg
ctggatcgctttcttcctcaagacggggagtacgaggcgaagcgcgccgacgtgcatagg
cgcttgaaggacaaccagcagaaactcacgaagtccctgaccaatcttgatgatctgaat
tcacaggttgagcgcttgcccaagctggaagagcagcttcgcggttttgatgagctgggg
atcaaggagaagctggccaagacctcattgctcgcacgcgagcgagagattgccaagacc
gctactgacggagtgcagagccttcgcgacgcgctttcagacttgcgtgacagcttgcct
gaccttgacttcatcaacgatgaggcgcttgagggcttgcctgacgcagcccagttgctc
gccatgcgtacgaccctggatggactcaagcaggggttcaccggccatctgactgcgatg
caggccttgcttgatgacaaggcaggacagttcaccacccagcatgacgtatggcagcag
gcgattcaggcgcacgatgtcgggttggagaaggcgctgcggacgttgcccgccactgcc
ggaaagagcgggcaggaggtcggtgttgcctatcagaagttgctgggggagatcgagcgg
atcaagcccatgaagtcgcgggcgactacgcaccagtcccagcgcgataccttgcgtcag
gaacggcgcaatctgttgaccgagctgtccgatttgcgtgggcagcgcatacaagcgttg
cagaaggccgcgaagcagctgaacaggcgacttgagggcaagctcaaggttgagatcgtg
ccggaggctgaccgcacgcccttgatgaccttcctgctgggttgcaagctggatggtgtt
ggcgaaaagcgacttgcgttcattgaggatgctgagacgatcagcccgctgtcgctggcc
cagtcgattcagaaagcgtctgccgacgtgcaactcgattggggcgtcacgcagatggtg
gctgacgcactcaccaagctccagtcgtctcagctcatggagctggaagccttggagctg
gagcatcgggcggacatctctttgaatgtcgctcacgcccaagccgatgcggtgttccgg
ccgctcaacaagctctctaccggccagcagtgcacggcaatcctgcacatgctgctgctt
gagaacgttgatccccttctgatggatcagccggaggacaaccttgacaacgccttcatc
gcagatcggatcgtcgccgagttgagggaggcaaagaccagtcggcagttcttgttcgcc
acacacaacgcgaacatcccggtgttcggcgatgccgagtggattggcgtgttcacggct
gccgagaaccaagggtgtctcgggctggaagcacaaggctcgattgacgttcctgtgatt
cgggatcaggtggcccgccttctggaaggcgggcgcgacgccttcattcagcgcaaagag
aagtacgagttctga

DBGET integrated database retrieval system