KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03557Help
Entry
PXO_03557         CDS       T00763                                 

Definition
(GenBank) microcystin dependent protein
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Collar
Motif
Other DBs
NCBI-ProteinID: ACD56967
UniProt: A0A0K0GFL5
Position
complement(316188..316733)
Genome map
AA seq 181 aa AA seqDB search
MSEFFIGQVMLTGFAFAPKYFAQCNGQLLPINQNQALFSLLSTRFGGDGKTTFGLPDMRG
RTPVGYGPSADPAWQPPAVPMGQAAGAETVTLVGDNLPPHTHLMSCSSANGDNRIPTGRL
FANNDIPSGTPHALYAAPGATVPLSQSTIASSGGGQAHPNVQPYTTINFCIALSGIFPSR
S
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaattcttcatcggtcaagtcatgttgaccggcttcgccttcgcaccgaagtac
ttcgcacagtgcaacggacagctattacctatcaatcagaaccaagccctgttcagtctg
ctcagcacccgcttcggcggcgacggcaagaccaccttcggcttgccggacatgcgcggg
cgcacgccggttggctatggaccgtcggccgatcctgcgtggcagccgccagcggtgccg
atgggccaggccgcgggcgcggagacggtgacgctggtgggcgacaacctgcccccgcat
acacacctgatgagttgcagcagcgccaacggcgacaaccgcataccgaccggccgcctg
ttcgccaacaacgacatcccgagtggaactccgcacgcgctgtacgccgcgccaggcgca
acggtgccgctgtcgcagtccaccatcgccagcagcggcggcggccaggcgcacccgaac
gtgcagccttacaccacgatcaatttctgcatcgcgctgtccggcatcttcccttcgcgc
agctag

DBGET integrated database retrieval system