KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03569Help
Entry
PXO_03569         CDS       T00763                                 

Definition
(GenBank) undecaprenyl-diphosphatase
  KO
K06153  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:xop00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PXO_03569
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xop01011]
    PXO_03569
Enzymes [BR:xop01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     PXO_03569
Peptidoglycan biosynthesis and degradation proteins [BR:xop01011]
 Precursor biosynthesis
  Diphosphatase
   PXO_03569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BacA
Motif
Other DBs
NCBI-ProteinID: ACD56955
UniProt: B2SHN5
Position
complement(304602..305399)
Genome map
AA seq 265 aa AA seqDB search
MSDLISALLLGILEGLTEFLPISSTGHLLIAEQWLGRRSDFFNIVIQAGAILAICLALRQ
RLWTLATGLGERDNRDYVLKVSVAFLVTAVVGLIVRKAGWQLPETLQPVAWALLIGGVWM
LVAEHVAGKLPERDVVTWKVAIAVGLAQVVAGVFPGTSRSASTIFIAMLLGLSRRSAAAD
FVFMVGIPTMFAASGYALLEMYKEGGFGTEHWADVAVAFVAATITGFVVVKWLLSYIKKH
RFTVFAVYRIVLGAALLLWLPAAAG
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatctgatttccgccctgctgttgggcattctcgaaggccttaccgaattcctg
ccgatctccagtaccggccatctgctgatcgccgaacaatggctcggacgccgttctgac
ttcttcaatatcgtcatccaggccggcgcgatcctggctatctgtctggcgctgcggcag
cggctgtggaccctggccaccggcctgggcgagcgcgacaaccgcgattacgtgctcaaa
gtcagcgtggccttcctggtcaccgcggtggtcgggctgatcgtgcgcaaggccggctgg
caattgcccgaaaccctgcagcccgtcgcctgggcgctgctgatcggcggcgtgtggatg
ctggtggccgaacacgtcgccggcaagctgcccgagcgcgacgtggtgacctggaaggtg
gccatcgcggtgggcctggcgcaggtcgtggccggtgttttcccaggcacctcgcgctcg
gcctcgacgatcttcatcgccatgttgctgggcctgagccggcgctcggcagcggcggat
ttcgtgttcatggtgggcattccgaccatgttcgcggccagcggttacgcgttgctggag
atgtacaaggaaggcggtttcggcaccgaacactgggccgatgtggcggtggccttcgtg
gcggcgaccatcaccggttttgtggtggtgaagtggctgctgagctatatcaagaagcac
cgtttcaccgtgtttgcggtgtaccgcatcgtgctcggcgcagccttgctgctgtggctg
ccggctgcggcgggctga

DBGET integrated database retrieval system