KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03571Help
Entry
PXO_03571         CDS       T00763                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 Lipase_GDSL_2 AlaDh_PNT_C SIS_2 Peripla_BP_6 Diphtheria_R
Motif
Other DBs
NCBI-ProteinID: ACD56952
UniProt: A0A0K0GG08
Position
302998..303594
Genome map
AA seq 198 aa AA seqDB search
MSRRWHRPQSPPGTPEVARIKAGDLVLCLGTVGVSMAALELAKRHGAHVAITSSSDEKLE
LARRLGADITVTYRTDPDWADAVTQLSGGGADVIIETGGQDTLGQSIKVAAANATIVVIG
VTPGTSSPIPDYVSLIRKNATIRGIANASRAMFVDLLRAIEQHRIKTLHNNTFRFDEAPQ
AFDYVARAQHVGKVLIQF
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcggcgctggcatcggccgcagtcaccgcctggcacgccggaagtcgccaggatc
aaggccggcgacctagtgctctgtctgggaaccgtcggcgtctcgatggccgcgctcgaa
ctcgccaagcgccacggtgcccatgtcgccatcacctcatccagcgacgagaagcttgaa
ctcgcgcgccgcctgggcgccgacatcaccgtcacctatcgcaccgatcccgactgggcc
gatgccgtgacgcagctgtccggcggcggcgcggacgtcatcatcgagaccggcgggcag
gacaccctgggacagtcgatcaaggtggcagctgccaacgcgaccatcgtggtgatcggc
gtcactcccggcacctcttcgccgattcccgactatgtgtcgttgatccgcaagaacgca
accattcgcgggatcgccaatgcaagccgggcgatgttcgtggacctgctgcgtgcgatc
gagcagcaccgcatcaagaccctgcacaacaacacgttccggttcgatgaggcgccccag
gcctttgattacgtcgccagggcgcaacacgtgggcaaggtcctgatccagttctga

DBGET integrated database retrieval system