KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03797Help
Entry
PXO_03797         CDS       T00763                                 

Definition
(GenBank) transposase
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_21 DUF1073
Motif
Other DBs
NCBI-ProteinID: ACD57071
UniProt: A0A0K0GGD6
Position
444716..445165
Genome map
AA seq 149 aa AA seqDB search
MAQQVRRHERARCQAAQGPGGREHATEEVAGRAGVPERPDQGCAAKTMVSAPARRALVRE
WIAGGASERCALAAIGMSASALRYRQREDRNVELRERILALAHRHRRYGVGMISLKLRQE
GRLVNYKRVERLYCEQQLQVRRRTRKRCR
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcagcaagttcggcggcatgagcgtgcccgatgccaagcggctcaaggacctgga
ggccgagaacacgcgactgaagaagttgctggccgagcaggtgttccagaacgacctgat
caaggatgcgctgcaaaaacaatggtgagcgcaccggcgcgtcgtgcgctggtgcgcgag
tggatcgcaggtggcgccagcgagcgctgcgccctggcagcgatcggcatgagcgccagt
gcgctgcgctatcgccagcgcgaggaccgcaacgttgagttgcgcgagcgcatccttgcg
ttggcgcatcgccatcgccgctatggcgtggggatgatctctctcaagctgcggcaggaa
ggtcgtctcgtgaactataagcgggtggagcggctgtattgcgagcagcagctgcaggtc
cgccgccgcacgcgtaaaaggtgccggtag

DBGET integrated database retrieval system