KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03800Help
Entry
PXO_03800         CDS       T00763                                 

Definition
(GenBank) transposase
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_32 TubC_N
Motif
Other DBs
NCBI-ProteinID: ACD57069
UniProt: A0A0J9WXQ7
Position
complement(443074..443268)
Genome map
AA seq 64 aa AA seqDB search
MRDHLVLWRWSPQQIAAKLSHMYPDDPAQRVSHETIYASIYAHPRGGLKKELVQALRQHK
PKRG
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
gtgcgagatcatctggtgctatggcgctggtcgccccagcagattgctgccaagctctcg
catatgtatccggatgatcctgcccagcgcgtcagccacgaaaccatttacgctagcatc
tacgcgcatccgcgtgggggcttgaagaaggaactggtccaggccctgcgtcagcacaag
cccaaacgcggatga

DBGET integrated database retrieval system