KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03806Help
Entry
PXO_03806         CDS       T00763                                 

Gene name
tetR
Definition
(GenBank) transcriptional regulator, TetR family
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N TetR_C_6 DUF3535
Motif
Other DBs
NCBI-ProteinID: ACD57063
UniProt: A0A0K0GG46
Position
complement(434227..434847)
Genome map
AA seq 206 aa AA seqDB search
MAYRRSALMEERLAGNRERILHAARILIAEGGYRNAQVTALAAAAGVSTGQIYRHFPSKA
ELFVEVLNEAVQRETTILRAIAATQASAAGRLRSAIATFVRRALAGPALAYAFIAEPVES
EVDAARIRGRRLFGEVFRQLLAEGVAAGEFPQQSLDAAAACIVGAFTEALVGPIAPSRGD
PQQGEQLVEAICGFCLRAVGAMQPTS
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggcctatcgacgctccgcactgatggaagaacgcctggccggcaaccgcgaacgcatc
ctgcacgcggcccgcatcctgatcgccgaaggcggctaccgcaacgcacaggtgactgcg
ttggcagccgctgcgggcgtttcgaccgggcagatttatcggcatttcccatcaaaagcg
gagcttttcgtggaagttctcaacgaggccgtacagcgtgagacaaccatcctgcgtgct
atcgccgccactcaggccagcgctgccgggcgtttgcgcagcgcgatcgccaccttcgta
cggcgcgccctggctggcccagcgctggcctacgcctttatcgccgagccggtagagagc
gaggtggacgccgcgcgtatccgtggccggcgcctgttcggggaggtttttcgccagctg
cttgcggaaggtgtggcggctggggagttcccgcagcagtcgctggatgccgccgcggcc
tgcatcgtcggcgcgtttaccgaagccttggtcgggccgatcgcccccagccgtggcgat
ccgcagcagggcgagcagctggtcgaagcgatctgcggcttctgcctgcgcgcggtgggc
gcaatgcaaccgaccagctga

DBGET integrated database retrieval system