KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03815Help
Entry
PXO_03815         CDS       T00763                                 

Definition
(GenBank) cytochrome C5
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrome_CBB3 Cytochrom_C Cytochrom_C550 Cytochrome_C554
Motif
Other DBs
NCBI-ProteinID: ACD57057
UniProt: A0A0K0GG23
Position
complement(429757..430218)
Genome map
AA seq 153 aa AA seqDB search
MVITLGLIALAAYLQRAVPDEVSPTAAKRVQQRIAPAGAVYAGATGASAQAAAQAAALAK
AASQSAYGGTTDGKTIFNNLCTACHTTGVGKAPTLDHSHWDARIAQGKDTLYKHAIEGYA
GPDGGIMPPKGGNPGLTEEQVRATVDWMLGNLK
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
gtggtgatcaccctgggcctaatcgctctggcagcttatttgcaacgcgctgttcccgac
gaagtctcgcctactgccgccaagcgcgtgcagcaacgcattgcgcctgccggtgcggtc
tatgccggcgccactggcgcctccgcccaggccgcggcccaggccgcagcgctggccaag
gccgcttcgcagtccgcgtacggcggcacaaccgacggcaagaccatctttaacaacctg
tgcaccgcctgccacaccacgggtgtaggcaaggcgccgacgctcgaccactcgcattgg
gatgcacgcatcgcccagggcaaggacaccttgtacaagcacgcgatcgagggctatgcc
gggccggatggcggcatcatgccccccaagggcggcaacccggggctgaccgaagagcag
gtgcgtgccaccgtcgattggatgctggggaatctgaagtaa

DBGET integrated database retrieval system