KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03817Help
Entry
PXO_03817         CDS       T00763                                 

Definition
(GenBank) hypothetical protein
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MerC
Motif
Other DBs
NCBI-ProteinID: ACD57055
UniProt: A0A0K0GFV9
Position
427290..427676
Genome map
AA seq 128 aa AA seqDB search
MRATASLLDSSAIALSGLCLLHCLALPLLAATLPLLGAWSRAEWVHVVFAMAAVPLSSYA
LWSTHRRHALPTSVCLLALCGLTGLVLGASGLVGDALETPITVTGSLLLASTHLLNLRLR
RRHGGCAR
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccaccgcctccttgctggatagctcggccatcgccttgtccgggttatgcctg
ttgcattgccttgccctgccgctgctggcggccacgctgccgctactcggtgcctggagc
cgggccgagtgggtacatgtggtgttcgccatggcagctgtgccgctgagcagctacgcg
ctatggagtacgcaccgccggcacgcgctgccgacatcggtctgtttgctggcgctctgt
gggttaaccgggttggtactgggtgcgagcggcctggtcggcgacgcgctggaaacaccg
atcacggtcaccggcagcctgctgctggccagcacgcatctgctcaatctgcgcctgcgt
cgccgacacggagggtgcgcgcgctga

DBGET integrated database retrieval system