KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03818Help
Entry
PXO_03818         CDS       T00763                                 

Definition
(GenBank) nitrile hydratase activator
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: cobW CobW_C RsgA_GTPase MeaB AAA_16 MobB AAA_22 T2SSE TsaE Viral_helicase1 AAA_33 MMR_HSR1 ATPase_2
Motif
Other DBs
NCBI-ProteinID: ACD57054
UniProt: A0A0K0GGB6
Position
complement(425903..427228)
Genome map
AA seq 441 aa AA seqDB search
MSLSPKRDSRLPVTVLSGFLGAGKTTLLNRILHNRDGLRVAVIVNDMSEVNIDAQLVREG
GAALRRTEETLVEFSNGCICCTLRDDLLQEVRRLAEQGRYDYLLIESTGIAEPMPVAATF
AVRDADGFSLSDIARLDTMVTVVDGSRFLQDFGSAATLAELGQQAGPDDTRGLVQLLGEQ
VEFADVLVISKCDRIDAQQLQRLRAVLRALNREAAIVDAAHGEVPLQQLLDTGRFDFTRA
QLAPGWMQELRGQHTPETEEYGISSFVYRARRPFHPQRFAHMVQSGLPQVIRSKGFFWLA
SRMDWVGELSSVGGATQTNAAGFWFAARHRVDAQSIGQPLQTSMTPLPYTDLGWQRQQTH
CWTAPLPQPHEVGDANEYAAMQRLWHPLWGDRRQELAVIGVEMDASRTRAALDACLLSDQ
ELRQGPAQWQLLDDPFPHWAR
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgtcccccaagcgcgattcacgcctccccgtcaccgtgttgtccggctttctg
ggcgcgggcaagaccaccttgctcaatcgcatcctgcataaccgcgacggtctgcgtgtg
gcggtgatcgtcaacgacatgagcgaggtcaacatcgacgcgcagctggtacgcgagggc
ggcgcggcgctgcggcgcaccgaagagacgctggtggaattcagtaacggctgcatctgc
tgcacgctgcgcgacgatctgctgcaggaagtgcggcggctggccgagcagggtcgctac
gactatctgctgatcgaatcgaccggtatcgccgagccgatgccggtcgccgccaccttc
gccgtgcgcgatgccgacggtttcagcctgtcggacattgcccggctcgacaccatggtg
acggtggtggacggcagccgttttctgcaggacttcggctcggccgccacgctggccgag
ctcggccagcaagccggcccggacgacacgcgcgggctggtgcagttgcttggcgaacag
gtggaatttgccgatgtgctggtgatcagcaaatgcgaccgcatcgatgcgcagcagctg
cagcgcctgcgcgcggtgctgcgtgcgctcaaccgcgaggcggcgattgtggatgcggcg
catggcgaggtgccgctgcagcagttgctcgacaccgggcgtttcgatttcacccgtgcg
cagctggcgccgggctggatgcaggaactgcgcggccagcacacgccggaaaccgaggaa
tacggcatcagcagcttcgtgtaccgcgcacgtcggccatttcatccgcagcgcttcgcg
cacatggtgcagagcggcctgccgcaggtgattcgcagcaaggggttcttctggttggcc
agtcgcatggattgggtgggcgaactgtccagcgtgggcggcgccacccagaccaatgca
gccggtttctggttcgctgcgcgccaccgcgtggatgcgcaatcgatcggccagccgctg
cagaccagtatgacgcccttgccctacaccgacctcggctggcagcggcaacagacgcac
tgctggaccgcgccgctgccgcaaccccatgaggtgggcgatgccaacgaatacgccgcg
atgcagcggctgtggcatccgctctggggcgaccgccgccaggaactggcagtgatcggc
gtggagatggacgcatcgcgcacgcgcgctgcgctggatgcctgcctgctcagcgatcag
gaactgcgtcaggggccggcgcaatggcagctgctggacgacccgtttccgcattgggcg
cgttga

DBGET integrated database retrieval system