KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03823Help
Entry
PXO_03823         CDS       T00763                                 

Definition
(GenBank) hypothetical protein
  KO
K07018  uncharacterized protein
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Brite
KEGG Orthology (KO) [BR:xop00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    PXO_03823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Peptidase_S15 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 DUF2235 Abhydrolase_2
Motif
Other DBs
NCBI-ProteinID: ACD57052
UniProt: A0A0K0GG18
Position
complement(422772..423434)
Genome map
AA seq 220 aa AA seqDB search
MSNPSFPTESAALTLQGPVGPLDVAVDLPEPGVAARAVTAIFCHPLSTEGGSMHNKVVTM
AARALRELGITVVRFNFRSVGNSAGTFDHGDGEQDDLRAVADWVRTQRPGDTVWLGGFSF
GAYVSLRAAGSIAPQVLISIAPPAGRWDFSDMQPPAQWLVIQGDADEIVEPQAVYDWLDT
LEQPPELVRMPDTSHFFHRKLIDLRGAIQHGVRRWLPAAV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatccctcattccccaccgaatcggctgcgttgacgctgcaggggccggtcggc
ccgctggatgtcgcggtcgatctgcccgagccgggtgttgccgcacgcgcggtcaccgcc
atcttctgccatccgctctccaccgagggcggcagcatgcacaacaaggtggtcaccatg
gccgcgcgcgcgctgcgcgagctgggcatcaccgtggtgcgcttcaatttccgcagcgtc
ggcaattcggcgggcacattcgatcatggcgatggcgagcaggacgatctgcgtgcggtc
gccgactgggtgcgcacgcagcgcccgggcgacacagtgtggttgggcggtttcagcttc
ggtgcctacgtgtcgctgcgtgctgccggatccatcgcaccgcaggtgctgatttcgatc
gcaccgccggccgggcgctgggatttcagcgatatgcagccgccggcgcagtggttggtg
atccagggcgatgccgatgagatcgtcgaaccgcaagcggtctacgactggctggacacc
ctggaacagccccccgagttggtgcgcatgcccgacaccagccatttcttccaccgcaaa
ttgatcgacctgcgcggtgcgatccagcatggtgtccggcgctggttgccggccgcagtc
tga

DBGET integrated database retrieval system