KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03824Help
Entry
PXO_03824         CDS       T00763                                 

Definition
(GenBank) ATPase
  KO
K06916  cell division protein ZapE
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Brite
KEGG Orthology (KO) [BR:xop00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xop03036]
    PXO_03824
Chromosome and associated proteins [BR:xop03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    PXO_03824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFG1_ATPase AAA_16
Motif
Other DBs
NCBI-ProteinID: ACD57051
UniProt: A0A0K0GG92
Position
complement(421599..422684)
Genome map
AA seq 361 aa AA seqDB search
MTPSQRYAAGVQRGDWRADPAQRAALAELDRIHEALVDGEQDGWLDRLSAFWKKPEPVRG
LYVWGGVGRGKTFLVDLFYDGLPIKQKYRTHFHRFMRGVHEQLREHAGQSDPLARIAQQW
RENLRVLVLDEFFVTDIGDAMLLARLLERLFAEGVTLVTTSNTAPQNLYANGLQRDSFMP
AIALLQKFCVELYAEGTEDYRMRALTRAPVYRAPLDAQADAWLAQRWSELSGNAEARAGN
IEIESRKIPVRARGKSIAWFDFAALCEGPRGPGDYIEIAREFTTVLLGGIPHFDRMNEDA
ARRFVNLIDELYDRHVNLVCTAQDAPPALYSGQRLAGAFERTASRLIEMQSADYLATAHR
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgtcgcagcgctacgccgccggcgtacaacgcggtgactggcgcgccgacccc
gcgcaacgggcggccctggcggaactggaccgtattcacgaagcgttggtggacggcgaa
caggacggttggctcgatcggctatcggcgttctggaaaaaacccgaaccggtacgtggc
ctgtatgtctggggcggtgtcgggcgcggcaagacctttctggtcgatctgttctacgac
ggcctgccgatcaagcagaaataccgcacgcatttccaccgtttcatgcgcggcgtgcac
gagcagttgcgcgagcatgccgggcaaagcgatccgctggccagaatcgcccagcagtgg
cgcgagaatctgcgcgtgctggtgctggacgaattcttcgtcaccgatatcggcgatgcg
atgttgctggcgcgcctgctcgaacgcctgttcgccgaaggcgtcacgctggtgaccaca
tccaataccgcgccgcaaaatctctacgccaacggattgcagcgcgacagcttcatgcca
gcgatcgcgctgctacagaagttctgcgtggagctctatgcagaaggcaccgaggattac
cgcatgcgcgcactgacgcgcgcgccggtgtatcgcgcacccttggacgcgcaagccgat
gcctggcttgcgcagcgctggagcgagttgagcggtaacgccgaggcgcgcgcgggcaat
atcgaaatcgaatcgcgcaagattccggtgcgtgcacgtggcaagagtatcgcctggttc
gattttgccgcgctgtgcgaaggcccgcgcggacccggcgactacatcgagatcgcgcgc
gagttcactacggtattgctgggcggcattccgcacttcgaccgcatgaacgaagatgcc
gcgcgccgcttcgtcaacctgatcgatgagctgtacgaccgccacgtcaatctggtctgc
accgcacaagacgcaccgccggccttgtacagcggccagcgcctggccggcgccttcgaa
cgcaccgcctcgcgcctgatcgaaatgcagagcgcggactacctggccacagcgcatcgc
gcgtaa

DBGET integrated database retrieval system