KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03850Help
Entry
PXO_03850         CDS       T00763                                 

Definition
(GenBank) hypothetical protein
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACD57024
UniProt: A0A0K0GFT0
Position
complement(385646..385810)
Genome map
AA seq 54 aa AA seqDB search
MTTRETVIGDTFASAATSSMVVARLVRRTDFLTLSKRGLFKCVRKLRDAQALLR
NT seq 165 nt NT seq  +upstreamnt  +downstreamnt
ttgaccacgcgcgaaaccgtcatcggcgacaccttcgccagcgccgccacctcgtcgatg
gtggtcgcgcggctggtgcggcggaccgatttcctgaccttgtccaaacgtggcctcttc
aaatgcgtgcgaaagctgcgggatgcacaggcactgctgcggtaa

DBGET integrated database retrieval system