KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03853Help
Entry
PXO_03853         CDS       T00763                                 

Definition
(GenBank) sialic acid-specific 9-O-acetylesterase
  KO
K05970  sialate O-acetylesterase [EC:3.1.1.53]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Brite
KEGG Orthology (KO) [BR:xop00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PXO_03853
Enzymes [BR:xop01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.53  sialate O-acetylesterase
     PXO_03853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SASA Glyco_hydro_2_N BetaGal_dom4_5 RdgC
Motif
Other DBs
NCBI-ProteinID: ACD57021
UniProt: A0A0K0GFZ2
Position
complement(381372..383312)
Genome map
AA seq 646 aa AA seqDB search
MIGTLSALLLPHLAGAADAPLLHPVFQDHVVLQRDAPIRLWGDAAPGTRVTVQLESAQVQ
ARADRQGHWEARLPAHAAGGPYSLKASAADGVVQQIDDVLIGDVWLCSGQSNMELQVHRT
LDSRSEIADADHPTIRMFKVPAQSSPTPQRGFGGAATWQRTTPETVKDFSAACYYFAREL
QKSVDVPMGLINASWGGSQLQAWIGDKALRAAGDNGPALDVLARYATDPVAAAPRWAALW
ETWWHAHGEGEPWQPDAPGHWQNAPPALGAWDDWGVPQLVGFNGMVWYRTSVELTQAQAA
QDATLLLGPVDELDQTWVNGRGVGSSYGADQPRRYALPRGRLHAGRNSIVLNVLNTYRRG
GLLGDAQSRALQFADGSTLALDAPWHYRIVSPTVGTPPRAPWSSAAGLTTLYNGMIAPLG
QLGLRGALWYQGESNTGDAVHYPALLSAWQRDWRQRFGAELPLLVVQLANYGAPPTQPAE
SGWAQLREAQRRFVADDAHAGLAVAIDIGDRYDIHPANKQELGRRLARAARHVVYGEAMA
ASGPVPRSARRDGEDVRIGFDDVDTALLSYGNDAPIGFELCGGAAGSCRYTRATLSGREI
RLRIPAGMQATRVRYCWADSPVCTLYDRSGLPAGPFELPITAAPSP
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
ttgatcggcacgctgtcggcgttgctgctgccgcaccttgccggcgctgcagatgcaccg
ctgctgcatcccgtgttccaggaccatgtggtgctgcagcgcgatgcgccgattcggctg
tggggcgatgcagcgccaggcacgcgtgtgaccgtgcaactggagagtgcgcaggtgcag
gcgcgtgcagaccgacaaggacactgggaggcgcgcctgcccgcgcatgccgccggcggc
ccgtacagcctgaaggccagcgctgccgacggtgtggtgcagcagatcgatgatgtcttg
atcggcgatgtctggctgtgttcgggacaatcgaacatggaactgcaggtgcatcgcacg
ctggattcgcgcagcgagattgccgatgccgaccatcccaccatccgcatgttcaaagtg
cctgcgcaatccagcccgacaccgcaacgcggtttcggtggcgctgcaacatggcagcgc
accacgccggagacggtgaaagatttttcggccgcgtgttactacttcgcacgtgagttg
caaaaaagtgtcgatgtgccgatgggcttgatcaacgcctcatggggcggttcgcaactg
caggcctggatcggcgacaaggcgttgcgtgcagccggcgacaatggccctgcactggat
gtgctggcgcgttacgcaaccgacccggtggctgccgcgccgcgctgggccgcgctgtgg
gaaacctggtggcatgcgcatggcgaaggcgaaccgtggcagccggatgcacctggccac
tggcagaatgcgccgccggcactgggcgcgtgggacgactggggcgtgccgcaattggtc
ggcttcaacggcatggtctggtaccgcaccagcgtcgaactgacccaggcacaggccgca
caagacgccacattgttactggggccggtggacgagctggaccagacctgggtcaacggg
cgcggcgtgggcagcagctatggcgccgatcaaccacgtcgctacgcgctaccgcgcgga
cggctgcatgccgggcgcaacagcatcgtgctcaatgtgctcaatacctatcggcgtggc
ggcttgctgggcgatgcgcaatcgcgcgcactgcagttcgccgatggcagcacgctggcg
ctggatgcgccctggcactaccgcatcgtgtcgccgacagtaggcacgccaccgcgtgcg
ccgtggtcgtcggctgccgggttgaccacgttgtacaacggcatgatcgcgccgctgggg
cagctgggcctgcgcggcgcgctgtggtaccagggcgaatccaatactggcgatgcggtg
cattaccccgccctactcagcgcatggcagcgcgactggcggcaacgcttcggcgcggag
cttccgctgctggtagtgcagctggccaattacggcgcaccgcccacgcaacctgccgaa
agcggttgggcgcaattgcgcgaggcgcagcggcgcttcgttgccgacgatgcacacgcg
gggttggcagtggccatcgatatcggcgaccgctacgacatccatccggccaacaagcag
gagctgggccggcgtttggcgcgtgcagcacggcatgtggtgtacggcgaagcgatggct
gcttccgggccggtgccgcgcagcgcacgccgcgacggcgaggacgtacgcatcggcttc
gacgatgtcgacaccgcgctactgagttacggcaacgacgcgccgatcggtttcgagcta
tgcggcggtgctgccggcagttgccgctatacccgtgccacgctgtccggtcgcgagatc
cgcctgcgtattcccgccggcatgcaggccacgcgggtgcgctactgctgggccgacagc
ccggtgtgcaccttgtacgaccgcagcggcctgccggccggccccttcgaacttcccatc
accgccgcaccttccccctga

DBGET integrated database retrieval system