KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03855Help
Entry
PXO_03855         CDS       T00763                                 

Definition
(GenBank) xylosidase; arabinosidase
  KO
K01198  xylan 1,4-beta-xylosidase [EC:3.2.1.37]
K01209  alpha-N-arabinofuranosidase [EC:3.2.1.55]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop00520  Amino sugar and nucleotide sugar metabolism
xop01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PXO_03855
Enzymes [BR:xop01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.37  xylan 1,4-beta-xylosidase
     PXO_03855
    3.2.1.55  non-reducing end alpha-L-arabinofuranosidase
     PXO_03855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: ACD57019
UniProt: A0A0K0GFS5
Position
complement(378401..380071)
Genome map
AA seq 556 aa AA seqDB search
MLIALAAPATAQAQASADVAFDWFDYRGDDAVFATSLPAGDYRNPILAGFYPDPSITQVG
NHYYLVNSTFTYFPAIPVFQSTDLVHWTQIGNVVERTDQLNYDGLEVSRGMFAPTIRYHN
GRYYVVGTSADNGGNFIASASNPAGPWSALSWLPGIDGIDLSLFFDTDGSGYLLNNGPPE
GTPQYEGHRAIWMQRFDLASNQPVGPRKVLLDRGVDPSSKPIWIEAPHLYQRNGWYYLSC
AEGGTLPDQQHRQVVLRSRHVWGPYASAPNNPILSQNALPAGRAHPVINAGHADFVTTPD
GQWWAVFLAARPYAGDRYNTGRETFLLPVQWRDDWPSILPAGAPIPTIAKAPALAAAASD
QAPLSGNFTWHDDFDTSTLRRAWLFLRVPHQPLADLNTRTGWLTLHAGSQGLDGTGTPAF
LARRQQHTRFTASTALAVPIQSGVSGGLAAFQNASAWYALGVRRDGDGLEVFLDKRDGAQ
TSTLAHTHVALTTQVRLQISGDGGAYGFAFDADGRGWQVLRRDDDAGMLSTAQAGGFVGT
MIGPFAQLQPARPKED
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
ttgctcatcgccttggcggcgcctgcgaccgcgcaggcgcaagcgtctgccgatgtcgcc
ttcgattggttcgactaccgcggcgatgatgcggtgttcgccacatcgctgccggcaggc
gattaccgcaatccgatcctggccggcttctatcccgaccccagcatcacccaggtcggc
aaccactactacctggtcaattccaccttcacgtattttccagcgatcccggtcttccaa
agtaccgatctggtgcactggacgcagatcggcaatgtggtcgagcgcaccgaccagttg
aattacgacggtttggaggtgtcacgtggcatgttcgcgcccaccattcgctaccacaat
ggtcgctactacgtggtggggacctcggccgacaacggcggcaacttcatcgccagcgcc
agcaatccagccggtccatggtcggcgctgagctggctgcccggcatcgatggcatcgac
ctgtcgttgttcttcgacactgacggcagcggctacctgctcaacaacggaccgccggaa
ggcacgccacagtacgaaggtcaccgcgcgatctggatgcaacgcttcgacctggccagc
aatcaacctgtcggtccgcgcaaggtgttgttggaccgcggcgtggatccgagcagcaaa
ccgatctggatcgaagcgccgcacctgtatcagcgcaatgggtggtattacctgtcctgc
gccgaaggcggtaccctgccggaccagcagcatcggcaggttgtcttgcgcagccgtcac
gtctgggggccgtatgcatcggcgccgaacaatccgatcctgagccaaaacgccctgcct
gcggggcgggcgcatccggtcatcaacgccggccacgccgattttgtgaccacgcccgat
gggcaatggtgggcagtgttcctggccgcccgcccgtatgcaggtgatcgctacaacacc
gggcgcgaaaccttcctgttgccggtgcagtggcgcgacgactggccctcgatcctgccg
gcgggcgcgccgattcccacgatcgccaaggcccccgctctggccgccgccgctagcgac
caggcaccgttgtcgggcaacttcacctggcacgacgacttcgacaccagcaccttgcgg
cgcgcatggctattcctgcgcgtcccgcaccaaccgttggccgacctgaacacacgcacc
ggctggttgaccctgcatgccggcagccagggcctggacggcaccggtacgccggcgttc
ctagcacggcgacaacaacatacgcgcttcaccgccagcaccgcactagccgtgccaatc
cagtcgggtgtcagtgggggattggccgcatttcagaacgccagtgcctggtacgcgctc
ggtgtgcgccgcgatggcgatggactggaagtgttcctggacaaacgcgacggtgcgcaa
accagcacgctcgcccacacccacgtcgcactcaccacgcaggtgcgcttgcagatcagt
ggcgatggcggcgcatatggtttcgccttcgatgcagatggccgcggctggcaggtactg
cggcgcgatgacgatgccggcatgctcagcaccgcgcaggcgggtgggttcgtcggcacc
atgatcgggccgtttgcccagctgcaacccgcacgccccaaggaggactga

DBGET integrated database retrieval system