KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03857Help
Entry
PXO_03857         CDS       T00763                                 

Definition
(GenBank) D-mannonate oxidoreductase
  KO
K00040  fructuronate reductase [EC:1.1.1.57]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop00040  Pentose and glucuronate interconversions
xop01100  Metabolic pathways
Module
xop_M00061  D-Glucuronate degradation, D-glucuronate => pyruvate + D-glyceraldehyde 3P
Brite
KEGG Orthology (KO) [BR:xop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PXO_03857
Enzymes [BR:xop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.57  fructuronate reductase
     PXO_03857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh
Motif
Other DBs
NCBI-ProteinID: ACD57017
UniProt: A0A0K0GG07
Position
complement(373989..375365)
Genome map
AA seq 458 aa AA seqDB search
MHLGAGAFHRAHQAVYIDDLLDDDPSWAISAVSLHSPQLRDALRPQDGLYTLALLDQHPQ
LRVIGAIREVLCAADEHAAVLARLADPGVRLVTLTVTEKGYCLAGDTLDLTHPDIAHDIA
NPANPRSAIGYLVAGLQQRMHSGTAPFTALSCDNLTDNGTLLERSVVRLAEQTDPALAEW
IAQHATFPRSMVDSITPATDDALRMRVQDQLGVHDAWPIQRERYSQWVIEDRFCNGRPAF
ERAGVTLSEDLAGYARAKLRLLNAPHSALAYLGSLLQLETVADAMRHSELAAFVETSMRA
EIAPTLQSMEGFDAQRYSNAILARFRNPAIRHRLAQIAWDGSQKIPVRLLGTIGDALAAG
QPMQRLCLAVAAWLHFIRRQAHEGVPLVDPLNDALSALGRTTTGDARHDVAAFLTLDAVF
GSLSADMRFSACVQTAYAALGTGTPTDVTQALGSMRDV
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
gtgcatctcggcgcaggcgccttccatcgcgcccatcaggccgtctatatcgacgacctg
cttgacgacgaccccagctgggcgatcagcgccgtctcgctacatagcccgcagctgcgc
gatgccttacgtccgcaggatggtctgtacaccctcgccctgctcgaccaacacccgcaa
ctgcgtgtcatcggcgccatccgcgaagtgctctgcgccgcggacgaacacgctgccgtg
ctcgcgcggcttgccgaccccggggtgcgcctggtcaccctcaccgtcaccgagaagggc
tattgcctggccggcgacacgctcgacctcacgcatcccgacatcgcacacgacattgcc
aaccccgcaaatccgcgcagcgccatcggctacctcgtcgccgggctgcagcagcgcatg
cacagcggcaccgcgccgttcaccgcgctcagctgcgacaatttgaccgacaacggcacg
ctgctagagcggtccgttgtgcggcttgcagaacagaccgaccccgcgcttgcggagtgg
atcgcgcagcacgcgaccttcccgcgctccatggtcgacagcatcacgcccgccaccgac
gacgcgctgcggatgcgtgtgcaagatcagctcggtgtgcacgatgcctggccgattcag
cgtgagcgctacagccagtgggtgatcgaagatcgcttctgcaacggccgccctgcattc
gaacgcgcgggcgtcaccctgagcgaagacctcgccggctacgcacgcgccaagctgcgc
ctgctcaatgcaccccactctgcattggcgtatctcggcagcctgctacagctggagacg
gtggccgacgccatgcgtcactccgaacttgccgcgttcgtggaaacgtcgatgcgcgcc
gagatcgcgccgactctgcagtccatggagggctttgatgcgcaacgctacagcaacgcc
atccttgcccgttttcgcaatcccgccatccgccaccgactcgcccagatcgcctgggac
ggctcgcagaagataccggtacgcctgctcggcacgatcggcgacgcactcgctgccggc
cagccgatgcagcgcctatgcctggcggttgccgcatggctgcatttcatccgcaggcag
gcgcatgaaggcgtgccgttggtcgatccattgaacgatgctctcagtgcgttgggacgc
acaacgactggggatgcgcgtcatgatgtcgctgcgtttctgacgctggatgcggtgttc
ggatcgttgtctgcagatatgcgcttttctgcttgcgtgcagacggcttatgcggcgcta
ggcactggcaccccgactgacgtgacacaggcacttggatcgatgcgtgatgtgtaa

DBGET integrated database retrieval system