KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03878Help
Entry
PXO_03878         CDS       T00763                                 

Gene name
desA3
Definition
(GenBank) DesA3_2
  KO
K00508  linoleoyl-CoA desaturase [EC:1.14.19.3]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xop00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    PXO_03878 (desA3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:xop01004]
    PXO_03878 (desA3)
Enzymes [BR:xop01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     PXO_03878 (desA3)
Lipid biosynthesis proteins [BR:xop01004]
 Desaturase
  Front-end
   PXO_03878 (desA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: ACD56998
UniProt: A0A0K0GG50
Position
354312..355433
Genome map
AA seq 373 aa AA seqDB search
MSRVHNRALSAAELQSFGDELDAIRARVQRQVGGADARYIRRIVAAVRWSGGAGRALLFL
GAFVRSVLIPAWIAGVVLLTLSKILENMELGHNVMHGQYDWMGDPQLNGNTYEWDIVATG
DNWRKTHNFKHHTYTNVRGMDDDIGYGLLRIFPEQRWRPFYLLQPFIAVVFALLFEWGVA
IQDLRLGRWFAGKIKAAELRVAFLPVGRKMGRQMLKDYIVFPLLAGPFFLTVLLGNLAAN
VLRSIWTFVIIFCGHFTADAEVFPKESIRNESRGHWYLRQLRGSSNLTGGKLMNVLSGNL
SHQIEHHFYPDLPANRYAQIAVEVKQICARYGQHYNTGSLPRQFAQVMWRIVRHAFPSRP
KPVHQRSSALQSA
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgagccgagtccataaccgtgccctgtccgctgccgaactgcagtctttcggcgacgaa
ctcgatgccatccgcgctcgcgtgcaacgccaggtggggggcgccgatgcgcgctacatc
cgccgcatcgtggctgccgtgcgctggagcggtggggctggtcgtgcgctgctgttcctt
ggcgcgttcgtccgtagcgtgctgattccggcgtggatcgccggcgtggtgctgctgacg
ctgtccaagatcctggagaacatggagctgggccataacgtcatgcacggccagtacgac
tggatgggcgacccgcagctcaacggcaatacctacgagtgggacatcgttgccaccggc
gacaactggcgcaagacgcacaacttcaagcaccacacctacaccaatgtgcgcggcatg
gacgacgacatcggctacggcttgttgcgtatcttccccgaacagcgctggcgcccgttc
tacctgctgcagcccttcatcgcggtggtgttcgcgctgctgttcgaatggggcgtggcg
atccaggacctgcgtctgggccgctggttcgccggcaagataaaggcggccgaattgcgc
gtcgcgttcctgcctgtgggccgcaagatgggccgccagatgctcaaggactacatcgtg
ttcccgctgctggccggcccgtttttcctgaccgtgctgctgggtaatcttgccgccaac
gtgctgcgcagcatctggaccttcgtgatcattttttgcggccacttcaccgccgatgcg
gaagtgttcccgaaggaatcgatccgcaacgaatcgcgtggtcattggtatctgcgtcag
ctgcgcgggtcgtcgaacctcaccggcggcaagttgatgaacgtgctgtctggcaatctg
agccaccagatcgaacaccacttctacccggacctgccagccaaccgttatgcgcagatc
gccgtcgaagtgaagcagatctgtgcgcgctacggccagcactacaacaccggctcgctg
ccgcggcagttcgctcaggtgatgtggcggatcgtgcgccacgccttcccgagccggccc
aagccggtgcaccagcgcagcagtgccttgcagagcgcgtaa

DBGET integrated database retrieval system