KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03880Help
Entry
PXO_03880         CDS       T00763                                 

Gene name
tetR
Definition
(GenBank) transcriptional regulator TetR family
  KO
K22105  TetR/AcrR family transcriptional regulator, fatty acid biosynthesis regulator
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Brite
KEGG Orthology (KO) [BR:xop00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xop03000]
    PXO_03880 (tetR)
Transcription factors [BR:xop03000]
 Prokaryotic Type
  Helix-turn-helix
   TetR/AcrR family
    PXO_03880 (tetR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N UBA_5 TetR_C_15 PqqD
Motif
Other DBs
NCBI-ProteinID: ACD56996
UniProt: A0A0K0GG69
Position
complement(352453..353133)
Genome map
AA seq 226 aa AA seqDB search
MTSIALPSHDAPPSRKPAISREDLIAAALSLIGPHRSLSTLSLREVAREAGIAPNSFYRQ
FRDMDELAVALIDLAGRSLRTIIGQARQRATSTDRSVIRVSVEAFMEQLRADDKLLHVLL
REGAVGSDAFKLAVERELSYFEDELRVDLIRLAAADNAKLHAPALVSKAITRLVFAMGAV
AMDSPPEKDPELIEQISQMLRMILTGARTLGTHGGGFNSGSQHQRL
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgacctccatcgccctgccttcccacgacgcgccgccgtcccgcaagccggcgatttca
cgggaggatctcattgctgcagcgttgtcgttgatcggcccgcaccgcagcctgtccacg
ctgagcctgcgcgaagtggcacgcgaggccggcatcgctccgaacagcttttaccgccag
ttccgcgacatggacgagctcgccgtggccttgatcgacctggccgggcgttcgctgcgc
accatcatcggccaggcgcgccagcgcgcgacctccaccgaccgcagcgtcatccgcgtc
tcggtcgaagccttcatggaacagctccgcgccgacgacaagctattgcacgtgctgctg
cgcgaaggcgcggtgggctcggacgccttcaagctggcggtggaacgcgaactcagctat
ttcgaagacgagctgcgtgtggacctgatccgcctggccgccgccgacaacgccaagctc
cacgcgcccgccctggtgtccaaggccatcacccggctggtgtttgcgatgggcgcggtc
gcaatggattcgccgccggaaaaagacccagagctgatcgagcagatctcgcagatgctg
cgcatgattctgaccggcgcccgcaccctgggcacacacggcggcggcttcaactctgga
tcgcaacaccaacggttgtga

DBGET integrated database retrieval system