KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03885Help
Entry
PXO_03885         CDS       T00763                                 

Definition
(GenBank) hypothetical protein
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3182
Motif
Other DBs
NCBI-ProteinID: ACD56991
UniProt: A0A0K0GG63
Position
348659..349012
Genome map
AA seq 117 aa AA seqDB search
MLLTQVLDCLPDIYPGTHGAVLERTILQPLTHRVGELCVAGIQIAYYGTQCSVPNADGSD
VYGGSALRAYRRSLESLVATALPPLEQRGGRTGVQIRSIPHLRLSWAADHAPQLRCG
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
ttgctgctgacgcaggtgctggactgcctgcccgacatctatccaggcacgcatggcgcg
gtgctggagcgcactatcctgcagccgctgacgcatcgcgtgggcgagctgtgcgtcgcc
ggcatccagattgcgtactacggcacgcaatgcagcgtacccaacgcggatggcagcgat
gtctacggcggctcggcgctgcgcgcgtaccgcagatcgctggaatcgctggtggccacc
gcattgccaccacttgagcagcggggtggtcgaacaggcgtgcagatacgatcgattcct
cacctccgcttatcctgggctgcagatcacgcgccgcaactacgatgtggttag

DBGET integrated database retrieval system