KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03897Help
Entry
PXO_03897         CDS       T00763                                 

Definition
(GenBank) hypothetical protein
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4123 DUF2510
Motif
Other DBs
NCBI-ProteinID: ACD56981
UniProt: A0A0K0GG52
Position
339416..339892
Genome map
AA seq 158 aa AA seqDB search
MQRYVLVDASARPDTPQALRYYLQDLPHRSLFARQPEAEHADLGPWLVQLPEFGQDPIEG
WLRALEQGHPAVAWLDSAGNFDAVFDHLETCLDLRRPNGTLALLRYWDGRVFVRLQRILT
ANQRLQLLGPIARWRTRVLGEDVVVSLSATDGQEHSDA
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgctacgtgctcgtcgatgcctcggcccgtcccgataccccgcaggcgttgcgc
tactacctgcaggacctgccgcaccgttccctgttcgcccgccagcccgaggccgagcac
gccgatcttgggccctggctggtgcaactgcccgagttcggccaagaccccatcgaaggc
tggctcagggccctggagcaggggcatcccgcggttgcttggctcgatagtgcgggcaac
ttcgacgccgtgttcgaccacttggaaacctgcctggatctgcgccgtccgaacggcaca
ttggcgctgctgcgctactgggacggacgggtgttcgtccgcctgcaacggattctgacc
gccaaccagcgcttgcaattgctcgggccaatcgcgcgttggcgaacgcgtgtgctgggc
gaggatgtggtggtgagcctctcggccaccgacggacaggagcacagcgatgcttga

DBGET integrated database retrieval system