KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03899Help
Entry
PXO_03899         CDS       T00763                                 

Definition
(GenBank) lipoprotein, putative
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipin_N
Motif
Other DBs
NCBI-ProteinID: ACD56979
UniProt: A0A0K0GFV1
Position
complement(337949..338269)
Genome map
AA seq 106 aa AA seqDB search
MGTALAAALLMSGCAKVESEKFVGHWVNLQSQDETMDIERNGETFMVRSTTPKFFSRQPK
TESYPAVYKDGALQVTNDGETVNFAIDESNGHLNTGGEQYERVPAK
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccgcgctggccgcggcactgttgatgagcggttgcgccaaggtggaaagcgag
aagttcgttggtcactgggtcaacctgcagtcgcaggacgagacgatggacatcgagcgc
aatggcgagaccttcatggttcgcagcaccacgccgaagttcttcagccgccagcccaag
accgaaagctacccggcggtgtacaaggatggcgcgctgcaggtcaccaacgatggcgag
acggtgaacttcgccatcgacgagagcaatggccacctcaataccggtggtgagcagtac
gagcgcgtgccggccaaataa

DBGET integrated database retrieval system