KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03903Help
Entry
PXO_03903         CDS       T00763                                 

Gene name
higA
Definition
(GenBank) addiction module antidote protein, HigA family
  KO
K21498  antitoxin HigA-1
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Brite
KEGG Orthology (KO) [BR:xop00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:xop02048]
    PXO_03903 (higA)
Prokaryotic defense system [BR:xop02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   HigB-HigA
    PXO_03903 (higA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_19 HTH_31 YdaS_antitoxin HTH_26 HTH_24
Motif
Other DBs
NCBI-ProteinID: ACD56976
UniProt: A0A0K0GG47
Position
334886..335176
Genome map
AA seq 96 aa AA seqDB search
MTVLPNIHPGDILLEEFLEPLGISQNALARATGVPPRRINEIVLGKRGITADTAVRLAAA
LGTSERFWLGLQADYELEQAHRALGDLPARIKRLAA
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcctacccaatatccatcctggcgacattctgcttgaggagtttctcgagcct
ctgggcatcagccagaatgcactggcacgcgccaccggcgtcccgccgcgccgtatcaac
gaaatcgtgctgggcaagcgcggcatcactgccgacactgccgtgcgtctggccgccgcg
ttgggcacctccgagcgcttctggctgggcctgcaggccgactacgagctggaacaggcg
catcgcgcgctgggcgatttgccggcacggatcaagcggctggcggcgtga

DBGET integrated database retrieval system