KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_03994Help
Entry
PXO_03994         CDS       T00763                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop00020  Citrate cycle (TCA cycle)
xop00480  Glutathione metabolism
xop01100  Metabolic pathways
xop01110  Biosynthesis of secondary metabolites
xop01120  Microbial metabolism in diverse environments
xop01130  Biosynthesis of antibiotics
xop01200  Carbon metabolism
xop01210  2-Oxocarboxylic acid metabolism
xop01230  Biosynthesis of amino acids
Module
xop_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xop_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:xop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PXO_03994
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PXO_03994
Enzymes [BR:xop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PXO_03994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ACD57270
UniProt: A0A0K0GGX8
Position
640692..642923
Genome map
AA seq 743 aa AA seqDB search
MPNTPKILYTLTDEAPYLATQSLLPIIDAYTDTAGIVVETRDISLAGRILALFPEYLSDT
QKVADDLGELGELATTPEANIIKLPNISASVPQLKAAIKELQGQGYALPAYPDEPKDAAE
KDIKARYDKVKGSAVNPVLREGNSDRRAPLSVKNYARKHPHRMGKWSSDSKSHVSHMESG
DFFGSEQSTTLADAGTLKIEFVGADGSSTVLKDKVAVKAGEIVDAAVLSKRALASFIDAQ
IADAKARDVLFSVHLKATMMKVSDPVLFGVVVGEFYKDTLSRHADALKSVGFDPNNGIGD
LYARIGTLPEDQQARIKADIQAEYAQRPGLAMVNSDKGITNLHVPSDVIVDASMPAMIRD
SGQMWNAQGTLQDTKAVIPDRCYADVYQAVIDDCKAHGAFDPSTMGSVPNVGLMAQKAEE
YGSHDKTFQMAAAGTVKVTDGNGKTVFKHAVEAGDLWRMCQVKDAPIQDWVKLAVERARL
SDTPAVFWLDQARAHDAQVIAKVEQYLKDHDTNGLDIRILPPVEATAFSLERIRKGQDTI
SVTGNVLRDYLTDLFPIMELGTSAKMLSIVPLMAGGGLFETGAGGSAPKHVQQFVEENCL
RWDSLGEFLALAASLEHLGNRYDNPSATVLAKALDVANGQFLDNNKSPARKVGELDNRGS
HFYLAMYWAQALAAQTEDTALQGRFAPLARALTENEATIVAELNGAQGKPVDIGGYYHPD
LAKVSEAMRPSKTFNDILATLKA
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgcctaatacccccaagatcctctacacgctcaccgacgaagcaccttacctggccacg
cagtcgctgctgccgatcatcgatgcctacaccgacaccgccggcatcgtggtcgaaacg
cgcgatatctcgctggccgggcgcatcctggcgctgtttcccgagtatttgagcgacacg
caaaaggttgccgacgatctgggcgaactcggtgagctggctaccacgccggaagccaac
atcatcaagctgcccaacatcagcgcctcggtgccgcagctcaaggctgcgatcaaggag
ctgcagggccagggctatgcgctgccggcgtatccggacgagcccaaggacgcagccgaa
aaagacatcaaggcacgctacgacaaggtcaagggcagtgcggtgaatccagtgctgcgc
gaaggcaattccgatcgtcgcgcaccgctgtcggtgaagaactatgcgcgcaagcacccg
caccgcatgggcaagtggagcagcgattccaagtcgcacgtgtcgcacatggagtctggc
gatttcttcggtagcgagcagtccaccacgctggccgacgccggcacgctcaagatcgaa
ttcgtcggtgccgacggcagcagcaccgtgctgaaggacaaggtcgcggtcaaagccggt
gaaatcgtcgatgccgcggtgttgagcaagcgcgcgctggccagcttcatcgacgcgcag
attgccgatgccaaggcccgcgacgtgctgttctcggtgcatctgaaagccaccatgatg
aaggtctccgatccggtgctgttcggtgtggtggtcggcgagttctataaggacacgctg
agcaggcatgccgatgcgctcaagtctgtcggcttcgatcccaacaacggcatcggcgat
ttgtacgcacgcatcggcacgttgccggaagaccagcaggcacggatcaaggccgatatc
caggccgaatacgcgcagcgccctgggctggcgatggtcaattcggacaagggcatcacc
aatctgcatgtgcccagcgacgtgatcgtcgatgcatccatgccggcgatgattcgcgac
tccggccagatgtggaacgcgcaaggcacgttgcaggataccaaggcggtgattccggac
cgttgctacgccgacgtgtatcaggcagtgatcgacgactgcaaggcgcacggcgcgttc
gatccgtccacaatgggctcggtgcccaatgtgggcttgatggcgcagaaggccgaagaa
tacggctcacacgacaagacctttcagatggccgctgccggcaccgtcaaggtcaccgat
ggcaatggcaagacggtgttcaagcatgccgtggaagccggcgatctgtggcgcatgtgt
caggtcaaggacgcgccgatccaggactgggtcaagcttgccgtcgagcgcgcacgtctg
agcgacaccccggccgtgttctggctggaccaggcacgcgcgcacgatgcgcaggtcatt
gccaaggtcgaacagtatctgaaggatcacgacaccaatggcctggatatccgcatcctg
ccgccggtggaagcgacggccttctcgctggagcgcatccgcaagggccaggacaccatc
tcggttaccggcaatgtgctgcgcgattacctcaccgacctgttcccgatcatggagctg
ggcaccagcgccaagatgctttccatcgtgccgctgatggcaggtggcggtctgttcgaa
accggtgccggtggttcggcgcccaaacatgtgcagcagttcgtcgaagaaaactgcctg
cgctgggattcgctgggggaattcctggccctggctgcctcgctggagcacctgggcaac
cgttacgacaatccgtcggccacggtgctggccaaggcgctggatgtcgccaacggccag
ttcctggacaacaacaagtcgccggcgcgcaaggtcggcgagctcgacaaccgcggcagt
catttctatctggcgatgtactgggcgcaagccctggccgcgcagaccgaagacactgcg
ctgcagggcaggttcgcgccgctggccagggccctgaccgagaacgaagccaccatcgtg
gccgagctcaacggcgcacagggcaagccggtggacatcggtggttactaccatcccgat
ctggccaaggtcagcgaagcgatgcgtccaagcaagaccttcaacgatatcctggccacg
ttgaaagcctga

DBGET integrated database retrieval system