KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_04004Help
Entry
PXO_04004         CDS       T00763                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xop01100  Metabolic pathways
xop01110  Biosynthesis of secondary metabolites
xop01130  Biosynthesis of antibiotics
xop01230  Biosynthesis of amino acids
Module
xop_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PXO_04004 (trpC)
Enzymes [BR:xop01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PXO_04004 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ACD57280
UniProt: B2SL03
Position
648712..649509
Genome map
AA seq 265 aa AA seqDB search
MSDILNTILARKADEVAERSARVPLAELIARSADLPLTRGFAAAMQASIAAGDPAVIAEV
KKASPSKGVIRPDFHPADIAVSYEFGGATCLSVLTDVDFFQGSDAYLRQARDACTLPVLR
KDFTVDPYQVYEARVLGADCILLIVSALEDAQLADLSGLAMQLGLDVLVEVHDVDELERA
VQVPVPLIGINNRNLRTFEVTLQTTLDMRAAVPRDRVLVTESGIVTQADVQLMRSNDVNA
FLVGETFMRAAEPGESLRQLFFAHD
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcctcaacaccattcttgcccgcaaggccgacgaagtcgccgagcgcagt
gcgcgcgtgccgctggccgagttgatcgcgcgcagcgccgacctgccgctcacgcgcggt
tttgcggctgccatgcaggccagcatcgccgccggcgatccggccgtgattgccgaagtg
aagaaggccagcccgtccaagggcgtgatccggcccgacttccatccggccgatatcgcg
gtcagctatgagttcggcggcgcgacgtgcctgtcggtgctcaccgatgtggatttcttc
cagggatccgatgcctatctacggcaggcgcgcgacgcctgcaccctgccggtgctgcgc
aaggatttcaccgtcgacccgtatcaggtctatgaagcccgcgtgctcggtgccgactgc
atcctgttgatcgtctccgcattggaagatgcccaattggccgatttgtcggggctggcc
atgcagctgggcctggacgtgctggtggaagtgcacgatgtcgacgagctcgagcgtgcg
gtgcaggtgccggtgccgttgatcggcatcaataatcgcaacctgcgcactttcgaggtc
acgctgcagaccaccctggacatgcgcgccgcggtgccgcgcgaccgcgtgctggttacc
gaaagcggcatcgtcacccaggccgatgtgcaactgatgcgcagcaacgatgtgaacgcg
tttctggttggcgagaccttcatgcgcgcggccgaacccggcgagtcactgcgtcagcta
ttcttcgcgcatgactga

DBGET integrated database retrieval system