KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_04228Help
Entry
PXO_04228         CDS       T00763                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop00071  Fatty acid degradation
xop00072  Synthesis and degradation of ketone bodies
xop00280  Valine, leucine and isoleucine degradation
xop00310  Lysine degradation
xop00362  Benzoate degradation
xop00380  Tryptophan metabolism
xop00620  Pyruvate metabolism
xop00630  Glyoxylate and dicarboxylate metabolism
xop00640  Propanoate metabolism
xop00650  Butanoate metabolism
xop00900  Terpenoid backbone biosynthesis
xop01100  Metabolic pathways
xop01110  Biosynthesis of secondary metabolites
xop01120  Microbial metabolism in diverse environments
xop01130  Biosynthesis of antibiotics
xop01200  Carbon metabolism
xop01212  Fatty acid metabolism
xop02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PXO_04228
   00630 Glyoxylate and dicarboxylate metabolism
    PXO_04228
   00640 Propanoate metabolism
    PXO_04228
   00650 Butanoate metabolism
    PXO_04228
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PXO_04228
   00072 Synthesis and degradation of ketone bodies
    PXO_04228
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PXO_04228
   00310 Lysine degradation
    PXO_04228
   00380 Tryptophan metabolism
    PXO_04228
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PXO_04228
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PXO_04228
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PXO_04228
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xop04147]
    PXO_04228
Enzymes [BR:xop01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PXO_04228
Exosome [BR:xop04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PXO_04228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACD57420
UniProt: A0A0K0GGZ7
Position
complement(780685..781872)
Genome map
AA seq 395 aa AA seqDB search
MSVRTLGALVERFGLHGQQLGEVAMGAVIKHSSDWNLAREATLSSGLSPLTPGITLQRAC
GTSLDSVITIANKIALGQIDSGIGGGSDTTSEVPIVYGKKLRARLLAANRVKATGDKLKT
LLRGFKLGELKPEFPGVAEPRTGKSMGDHCEDMAKEWNISRDSQDEWAVASHHKLAAAYE
RGFFDALIAPFRGVSRDNILRADTSLEKLATLRPAFDKTSGRGTLTAANSTALTDGAAAV
LLSSEVWALAHGHTPMAYLRDAQVAAVDFVHGQGLLMAPTIAVPQMLARQGLTLQDFDIY
EIHEAFAAQVLCTLRAWESEDYCRNRLGLDAPLGRIDPDKINPLGSSLATGHPFAATGAR
VVATAAKQLEERGGGRALISICTAGGMGVVAIVER
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgcgcacgctgggcgcgctggtcgagcgcttcgggctgcatgggcagcaattg
ggcgaagtggcgatgggcgcggtgatcaagcactcctcggactggaatctggcccgcgag
gcgacgctgtcgtcgggtctgtcgccgctgacgccgggcatcaccctgcagcgcgcctgc
ggcaccagcctggattcggtgattaccatcgccaacaagatcgcgctggggcagatcgat
tcaggcatcggcggcggttcggacaccacctccgaagtgccgatcgtctacggcaagaaa
ctgcgcgcgcggctgttggccgccaatcgtgtcaaggccaccggcgacaagctcaagacg
ctgttgcgcggcttcaagctgggcgagctcaaacccgaattccccggcgtggccgaaccg
cgcaccggcaagagcatgggcgaccactgcgaggacatggccaaggaatggaacatctcg
cgcgattcgcaggacgaatgggcggtggcctcgcaccacaagctggccgctgcgtatgag
cgcggtttcttcgatgcgctgatcgccccgttccgcggcgtctcgcgcgacaacatcctg
cgcgccgacacctcgctggaaaaactcgccacgctgcgtcccgccttcgacaagacctcc
ggccgcggcacgctcaccgcggccaattccactgcgctgaccgatggcgccgccgcggtg
ctgctgtccagcgaagtctgggcgctggcgcatggtcacacaccgatggcctatctgcgc
gatgcacaagtcgcggcagtcgatttcgtgcatggccaaggcctgctgatggcgccgacc
atcgccgtgccgcaaatgctggcacgacagggcctgaccctgcaggacttcgacatctac
gaaatccacgaagccttcgctgcgcaggtgctgtgcacgctgcgcgcgtgggagagcgag
gattactgccgcaatcgcctgggcctggatgcgccgctgggccgcatcgaccccgacaag
atcaacccgctgggttcctcgctagccaccggccacccgttcgcggccactggtgcgcgt
gtggtggccacggccgccaagcagctggaagaacgcggcggcggccgtgcattgatttcg
atctgcaccgccggcggcatgggcgtggtggcgattgtcgagcgctga

DBGET integrated database retrieval system