KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_04516Help
Entry
PXO_04516         CDS       T00763                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
xop03010  Ribosome
Brite
KEGG Orthology (KO) [BR:xop00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    PXO_04516 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:xop03011]
    PXO_04516 (rplV)
Ribosome [BR:xop03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    PXO_04516 (rplV)
  Bacteria
    PXO_04516 (rplV)
  Archaea
    PXO_04516 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ACD57892
UniProt: B2SQR5
Position
1259826..1260161
Genome map
AA seq 111 aa AA seqDB search
MEAKAILRTARISPQKARLVADQVRGLSAERAVNLLKFSDKKAAHLIKKVVESAIANAEN
NQGADVDELKVKTIMVDEGPSLKRFMARAKGRGTRILKRTSHITVIVGAAK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgaaagcaatcctgcgcaccgcgcgcatctccccgcagaaggcccgcctggtc
gctgatcaggtgcgtggtttgtccgccgagcgtgcggtcaatttgctgaagttctcggac
aagaaggctgcacacctgatcaaaaaggtggtggagtcggctattgccaatgccgagaac
aatcagggcgcggatgtcgacgagctgaaggtcaagaccatcatggttgatgaaggtccg
tccctgaagcgtttcatggcgcgggcgaaaggccgcggtacccgcatcctcaagcgcacc
agtcacatcactgtgattgtcggcgccgccaagtaa

DBGET integrated database retrieval system