KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_05436Help
Entry
PXO_05436         CDS       T00763                                 

Definition
(GenBank) hypothetical protein
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACD56971
UniProt: A0A0K0GG43
Position
complement(324374..324541)
Genome map
AA seq 55 aa AA seqDB search
MRRCLLRCRRPVAALKRKAARHRVTALRGRCRATARHTPSIDNCNQRVGRDSLKK
NT seq 168 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcgttgtttgctgcggtgtcggcgcccggtggccgcgctgaaacgcaaggccgca
cgacaccgtgtaacagcgctacgcggaagatgccgggcaacggcgcgccacacaccaagc
atcgacaactgcaatcagagggtcggcagggattcgttaaaaaaatag

DBGET integrated database retrieval system