KEGG   Xanthomonas oryzae pv. oryzicola BLS256: XOC_0306Help
Entry
XOC_0306          CDS       T01873                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xor  Xanthomonas oryzae pv. oryzicola BLS256
Pathway
xor00071  Fatty acid degradation
xor00072  Synthesis and degradation of ketone bodies
xor00280  Valine, leucine and isoleucine degradation
xor00310  Lysine degradation
xor00362  Benzoate degradation
xor00380  Tryptophan metabolism
xor00620  Pyruvate metabolism
xor00630  Glyoxylate and dicarboxylate metabolism
xor00640  Propanoate metabolism
xor00650  Butanoate metabolism
xor00900  Terpenoid backbone biosynthesis
xor01100  Metabolic pathways
xor01110  Biosynthesis of secondary metabolites
xor01120  Microbial metabolism in diverse environments
xor01130  Biosynthesis of antibiotics
xor01200  Carbon metabolism
xor01212  Fatty acid metabolism
xor02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    XOC_0306
   00630 Glyoxylate and dicarboxylate metabolism
    XOC_0306
   00640 Propanoate metabolism
    XOC_0306
   00650 Butanoate metabolism
    XOC_0306
  Lipid metabolism
   00071 Fatty acid degradation
    XOC_0306
   00072 Synthesis and degradation of ketone bodies
    XOC_0306
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XOC_0306
   00310 Lysine degradation
    XOC_0306
   00380 Tryptophan metabolism
    XOC_0306
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XOC_0306
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XOC_0306
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XOC_0306
Enzymes [BR:xor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     XOC_0306
Exosome [BR:xor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XOC_0306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEQ94542
UniProt: G7TKM6
Position
304257..305552
Genome map
AA seq 431 aa AA seqDB search
MPGQPMPAARPVAILGGVRIPFCRQNTAYADVGNLGMSVRTLGALVERFGLHGQQLGEVA
MGAVIKHSSDWNLAREATLSSGLSPLTPGITLQRACGTSLDSVITIANKIALGQIDSGIG
GGSDTTSEVPIVYGKKLRARLLAANRVKANGDKLKTLLRGFKLGELKPEFPGVAEPRTGK
SMGDHCEDMAKEWNISRDSQDEWAVASHHKLAAAYERGFFDALIAPFRGVSRDNILRADT
SLEKLATLRPAFDKTSGRGTLTAANSTALTDGAAAVLLSSEAWALAHGHTPMAYLRDAQV
AAVDFVHGQGLLMAPTIAVPQMLARQGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCR
NRLGLDAPLGRIDPDKINPLGSSLATGHPFAATGARVVATAAKQLEQRGGGRALISICTA
GGMGVVAIVER
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtcaaccgatgcccgcagcccgtcccgtcgccattttaggcggcgttcgtatc
ccgttttgccgtcagaacaccgcatacgcggatgtaggcaacctgggtatgtcggtgcgc
acgctgggcgcgctggtcgagcgcttcgggctgcatgggcagcaattgggcgaagtggcg
atgggcgcggtgatcaagcactcctcggactggaatctggcccgcgaggcgacgctgtcg
tcgggtctgtcgccgctgacgccgggcatcaccctgcagcgcgcctgcggcaccagcctg
gattcggtgattaccatcgccaacaagatcgcgctggggcagatcgattcgggcatcggc
ggcggttcggacaccacctccgaagtgccgatcgtctacggcaagaaactgcgcgcgcgg
ctgttggccgccaatcgtgtcaaggccaacggcgacaagctcaagacgctgttgcgcggc
ttcaagctgggcgagctcaaacccgaattccccggcgtggccgaaccgcgcaccggcaag
agcatgggcgaccactgcgaggacatggccaaggaatggaacatctcgcgcgattcgcag
gacgaatgggcggtggcctcgcaccacaagctggccgctgcgtatgagcgcggtttcttc
gatgcgctgatcgccccgttccgcggcgtctcgcgcgacaacatcctgcgcgccgacacc
tcgctggaaaaacttgccacgctgcgtcccgccttcgacaagacctccggccgcggcacg
ctcaccgcggccaattccactgcgctgaccgatggcgccgccgcggtgctgctgtccagc
gaagcctgggcgctggcgcatggtcacacaccgatggcctatctgcgcgatgcacaagtc
gcggcagtcgatttcgtgcatggccaaggcctgctgatggcgccgaccatcgcagtgccg
caaatgctggcacgacagggcctgaccctgcaggacttcgacatctacgaaatccacgaa
gccttcgctgcgcaggtgctgtgcacgctgcgcgcgtgggagagcgaggattactgccgc
aatcgcctgggcctggatgcgccgctgggccgcatcgaccccgacaagatcaacccgctg
ggttcctcgctagccaccggccacccgttcgcggccactggtgcgcgtgtggtggccacg
gccgccaagcagctggaacaacgcggcggcggccgtgcattgatttcgatctgcaccgcc
ggcggcatgggcgtggtggcgattgtcgagcgctga

DBGET integrated database retrieval system