KEGG   Xanthomonas oryzae pv. oryzicola BLS256: XOC_1358Help
Entry
XOC_1358          CDS       T01873                                 

Definition
(GenBank) EvpF
  KO
K11896  type VI secretion system protein ImpG
Organism
xor  Xanthomonas oryzae pv. oryzicola BLS256
Brite
KEGG Orthology (KO) [BR:xor00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xor02044]
    XOC_1358
Secretion system [BR:xor02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   XOC_1358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF DUF2397
Motif
Other DBs
NCBI-ProteinID: AEQ95543
UniProt: G7TI23
Position
1345031..1346866
Genome map
AA seq 611 aa AA seqDB search
MQDLLPYYERELGYLRRYGREFAERYPKIAGRLQLSADGSQDPHVERLIEAFALMGARIS
KRIEDDYPEFTDALLEVLYPHYLRPFPSCSIAYFDMEGVAAKLSAPIRVPRGSYLQSRPV
RGINCRFRTAYDVVLVPVAVKAASYRGVAEAPMAVSLPPGTGAQISISFELLSDQASFAG
LGTDALRFFVDGEPSFCSAMRDALALGVKAAYVESDGSGRWRRLADTPLVPVGFADDESL
IDFPARSHPAYRLLTELFGYPDKFGFFDLQLKPVTAGASRWFTLHLVLHATPPDRAANQV
LEELDCKNIRLGCTPVVNLFAQHGEPIRVTHRSVTYPVIADGRRAFAYEVHSIDSVHRIR
QTPQGELIQEFRPFYSLHHGEDPERAGQYWVARRDEDVARESPGYETEVSFVDLEFNPTL
PQTDVVSVELTCSNRDLPSQLAYGIAGGDLSIEGGTPARAISLLRKPSRPLRFRHGRGAQ
WRLISHLSLNQLSLTGSGLPALKEMLRLYDISGSSVSSRQIDGIVGIEQYPVTTWLSGKH
FASVVRGLEVRLTISENHFVGTGVAAFAHVLDHFFGLYVHANSFIRLVLISSDTGEELVR
CLPRSGESILA
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacctgcttccctactacgaacgcgaactgggctatctgcgtcgctacgggcgc
gagttcgccgagcgctatcccaagattgccgggcgcctgcagctgtcggccgacggcagc
caggatccgcatgtcgagcgcctgatcgaggcgttcgcgctgatgggcgcgcgcatctcc
aagcgcattgaggacgactaccccgagttcaccgacgcgctgctggaagtgctgtatccg
cactatctgcggccgtttccgtcctgctccatcgcctatttcgacatggaaggcgtggct
gccaagctcagcgcgccgatccgcgtgccgcgcggtagctacctgcagtcgcgcccggtg
cgcgggatcaactgccggttccgcaccgcctacgacgtggtactggtgccggtggcggtg
aaggccgccagctaccgtggcgtggccgaagcgccgatggcggtcagcctgccgccgggc
accggcgcacagatctcgatcagcttcgagctgttgtccgaccaggcctcgttcgctggc
ctgggcaccgacgcgctgcgtttcttcgtcgacggcgagccgtcgttctgctcggcgatg
cgcgatgcgctggcgctgggggtcaaggcagcctatgtcgagtccgacggcagcggacgc
tggcgccggctggcggacaccccgctggtgccagtgggattcgccgacgacgaatcgctg
atcgatttcccggcgcgttcgcacccggcctaccgcctgctgaccgagctgttcggctac
ccggacaagttcggcttcttcgatcttcagctcaagccggtgaccgccggcgccagccgc
tggttcacgttgcacctggtcctacacgcgacgccgcccgatcgcgccgccaaccaagtg
ctcgaggagttggattgcaagaacatccgcctgggctgcaccccggtggtgaacctgttc
gcgcagcacggcgagccgatccgcgtcacccatcgcagcgtcacctatccggtgatcgcc
gacgggcgccgcgcctttgcctacgaagtgcattcgatcgattcggtgcaccgtatccgg
cagactccgcagggcgagctgatccaggagttccgcccgttctattcgctgcaccatggc
gaagaccccgagcgcgccggccagtattgggtggcgcggcgcgacgaggatgtggcgcgg
gagagtcccggttacgaaaccgaagtgagcttcgtggacctggaattcaatccgaccctg
ccgcagaccgatgtggtcagcgtcgaactcacctgcagcaatcgcgatttgcccagccag
ctcgcctacggcatcgccggcggcgacctgtcgatcgagggcggaacgccggcgcgcgcg
atcagcctgttgcgcaagccgagccggccactgcggttccgccacggacgcggcgcgcaa
tggcggctgatctcgcacctgtcgttgaatcagctgtcgctgaccggcagcggcttgccg
gcgttgaaggagatgctgcggctgtacgacatctccggcagcagcgtgtcgtcgcggcag
atcgacggcatcgtcggcatcgagcagtatccggtcaccacctggctgtccggcaagcat
ttcgcatcggtggtgcgcggcctggaagtgcgtttgaccatcagcgaaaaccatttcgtc
gggaccggcgtggccgcgttcgcgcatgtgctcgaccacttcttcggcctctacgtccac
gccaacagctttatccggctggtgctcatttccagcgacacaggggaggaactcgtccga
tgcttaccgcgaagcggcgaatcgatcctggcgtag

DBGET integrated database retrieval system