KEGG   Xanthomonas oryzae pv. oryzicola BLS256: XOC_3076Help
Entry
XOC_3076          CDS       T01873                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
xor  Xanthomonas oryzae pv. oryzicola BLS256
Pathway
xor00900  Terpenoid backbone biosynthesis
xor01100  Metabolic pathways
xor01110  Biosynthesis of secondary metabolites
xor01130  Biosynthesis of antibiotics
Module
xor_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XOC_3076 (dxr)
Enzymes [BR:xor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     XOC_3076 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C Semialdhyde_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AEQ97174
UniProt: G7TM23
Position
3140110..3141300
Genome map
AA seq 396 aa AA seqDB search
MAGSSLRQVAVFGATGSIGASALDVIARHPERLRASVLSAGSKVEDLLALCAAHRPAHAV
IADAALYPALRDGLRALGLATQAHAGAEALDALAGSDACDTVVAAIVGAAGLPSTLAAAR
AGKRLLLANKESLVLAGELLTRTATAAGAEIIPIDSEHSAIFQCLRSCDAGRGVRRVILT
ASGGPFRGRDRAALAAVTPAQAVAHPKWSMGPKISVDSATLMNKGLEVIEAHHLFGLPGE
QIDVLVHPQSLVHSLVEFVDGSTLAQLGLPDMRTTLAVGLAWPERVESGVGGLDLLSQGR
LDFEAPDTAAFPCLRLAWDALRAGGTAPAVLNAANEVAVSAFLQGKVGFLAIPALVEHAL
TTLPRHNADTLDTLLFADAQARQVTERALAHHALHA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctggttcttctctccgtcaggtcgccgtcttcggcgccaccggctcgatcggcgca
tcggcgctggacgtgatcgcgcgccaccccgagcggctgcgcgccagcgtgctgtcggcc
ggcagcaaggtcgaggacctgctggcgctgtgcgccgcgcaccggcctgcgcatgcggtg
atcgccgatgcagcgctgtacccggcgctacgcgatggcctgcgcgcgctcgggctggcg
acccaggcgcatgccggcgccgaggcgctggacgcactggccggcagcgacgcgtgcgac
accgtggtggcggcgatcgttggtgcggcggggctgccgtctacgctggcggcggcgcgc
gctggaaagcgtctgttgctggccaacaaggaatcgctggtgctggccggcgagttgctg
acccgcaccgcaaccgccgccggcgctgaaatcattccgatcgacagcgaacacagcgcc
atcttccagtgcctgcgctcctgcgacgctggccgcggcgtgcgccgggtcatcctgact
gcctccggtggcccgttccgtggccgggaccgcgcagcgctggcggcagtcacgcctgcg
caggcggtggcgcatcccaagtggtcgatggggccgaagatctcggtggattcggccacc
ctgatgaacaagggcctggaagtgatcgaggcgcatcacctgttcggcctgccgggcgag
cagatcgatgtgttggtgcacccgcaaagcctggtgcattcgctggtggaattcgtcgac
ggctccaccctggcccagcttggcctgccggacatgcgcaccactctggcggtgggcctg
gcctggccggagcgggtcgaatccggggttggcgggctggacctgctcagccagggccgg
ctggatttcgaggccccggacaccgccgcattcccgtgcctgcgcctggcctgggacgca
ttacgggccggtggcaccgcaccggcggtcctgaacgcggccaacgaagtcgctgtttca
gcgtttcttcagggcaaggtgggtttcctagcgatccctgcgttggtcgaacacgcactg
acaacgctcccgcggcacaatgccgacaccctcgacaccctgctttttgccgatgcgcaa
gcccggcaagtcactgaacgcgccctcgcccaccacgcccttcatgcctga

DBGET integrated database retrieval system