KEGG   Xanthomonas oryzae pv. oryzicola BLS256: XOC_3219Help
Entry
XOC_3219          CDS       T01873                                 

Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
xor  Xanthomonas oryzae pv. oryzicola BLS256
Pathway
xor00270  Cysteine and methionine metabolism
xor00920  Sulfur metabolism
xor01100  Metabolic pathways
xor01110  Biosynthesis of secondary metabolites
xor01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xor00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    XOC_3219
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    XOC_3219
Enzymes [BR:xor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     XOC_3219
    2.3.1.46  homoserine O-succinyltransferase
     XOC_3219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr DUF429
Motif
Other DBs
NCBI-ProteinID: AEQ97314
UniProt: G7TB13
Position
complement(3289307..3290329)
Genome map
AA seq 340 aa AA seqDB search
MNTASPSINDPVDTPTVIDDDITAVRGERVIALPMRHAGMRELRLRYELIGAANAPVVFV
AGGISAHRHLAASNLFPEKGWVDGLVGSGRALDPASRRLLAFDFLGADGSLDAPIDTADQ
ADAIAALLDALGIGRLHGFVGYSYGALVGLQFAIRHAARVGTLVAVSGAHRAHPYAAAWR
ALQRRAVALGQLQCAEQHGLALARQFAMLSYRTPEEFSERFDAPPEVINGRVRVAAEDYL
DAAGAQYVARTPVNAYLRLSESIDLHRIDPARVRVPTVVVAVEGDRLVPLADMVSLVEGL
GLRGSLRVLRSPYGHDAFLKEIDRIDAILTTALRSTGETA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgaatacagcatcgccgtctatcaacgatcccgttgacacccccaccgtcatcgatgac
gacatcactgccgtgcgcggcgaacgcgtcattgctctgccgatgcgccatgccggcatg
cgcgagctgcggctgcgctatgaactgatcggcgcggccaatgcgccggtggtgttcgtg
gccggcggcatctctgcgcaccgccatttggccgccagcaacctgttccctgagaagggc
tgggtggatgggctggtgggcagtggccgcgcgctggatccggcatcgcggcgtctgctc
gcgttcgactttctcggcgccgatggcagcctggatgcgccgatcgataccgccgatcag
gccgatgcgatcgctgcgttgctggacgcgttgggcatcggacgtttgcacggttttgtc
ggctattcctacggtgcgctggttggcctgcagttcgccattcgtcatgcggcccgcgtc
gggaccttggttgcggtaagtggtgcgcatcgtgcgcacccatatgccgcggcctggcgt
gcattgcagcgccgcgcggtggcgctgggccagctgcagtgcgcagaacagcacggtctg
gcgctggcccgtcagttcgccatgctcagctaccgcacgccggaagaattcagcgagcgc
ttcgatgcgccgccggaagtgatcaatggccgcgtgcgtgtggccgccgaagactatctg
gacgccgccggcgcgcagtacgtggcacgcacgccggtgaatgcctatttgcgtctgtcc
gaatccatcgacctgcaccgtatcgaccccgcgcgcgtgcgcgtgcccaccgtcgtggtg
gccgtggagggcgaccgcctggtgccgctggccgacatggtcagcctggtcgaaggcctg
ggcctgcgcggcagcctgcgcgtgttgcgctcgccttatggccacgacgccttcctcaaa
gaaatcgatcgtatcgatgcaatcctcactaccgcccttcgcagcaccggagaaaccgca
tga

DBGET integrated database retrieval system