KEGG   Xanthomonas oryzae pv. oryzicola BLS256: XOC_3819Help
Entry
XOC_3819          CDS       T01873                                 

Definition
(GenBank) DNA polymerase III holoenzyme chi subunit
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
xor  Xanthomonas oryzae pv. oryzicola BLS256
Pathway
xor00230  Purine metabolism
xor00240  Pyrimidine metabolism
xor01100  Metabolic pathways
xor03030  DNA replication
xor03430  Mismatch repair
xor03440  Homologous recombination
Module
xor_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    XOC_3819
   00240 Pyrimidine metabolism
    XOC_3819
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    XOC_3819
   03430 Mismatch repair
    XOC_3819
   03440 Homologous recombination
    XOC_3819
Enzymes [BR:xor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     XOC_3819
DNA replication proteins [BR:xor03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     XOC_3819
DNA repair and recombination proteins [BR:xor03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     XOC_3819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi Ycf54
Motif
Other DBs
NCBI-ProteinID: AEQ97909
UniProt: G7TGG2
Position
3950403..3950828
Genome map
AA seq 141 aa AA seqDB search
MPRADFYLIAKPRFLNEPLRLVCELARKANDANLSTLILARDAEQAEALDDLLWAFDDEA
YVPHQIAGTDEEDELAPVLIAAPEFAAPSRPLVINLRDDPYLGACDRVLEVVPADPAARE
PLRERWKQYKALGLELTKYDM
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtgccgacttctacctgatcgccaagccgcgctttctcaacgaaccgctgcgg
ctggtgtgcgagctggcgcgcaaggccaacgacgccaacctgtcgacgctgatcctggcc
cgcgatgcggagcaggccgaggcgttggacgacctgctgtgggcgttcgacgacgaagcc
tacgtgccgcaccagatcgccggcaccgatgaggaagacgagctggccccggtgctgatc
gccgcccccgagttcgccgctccctcgcgcccgctggtgatcaacctgcgcgacgacccg
tacctgggcgcctgcgaccgcgtgctggaagtggtgcccgccgacccggccgcccgcgaa
ccgctgcgcgagcgttggaaacagtacaaggccttgggcctggaactgaccaagtacgac
atgtga

DBGET integrated database retrieval system