KEGG   Xanthomonas oryzae pv. oryzicola BLS256: XOC_4210Help
Entry
XOC_4210          CDS       T01873                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
xor  Xanthomonas oryzae pv. oryzicola BLS256
Pathway
xor00260  Glycine, serine and threonine metabolism
xor01100  Metabolic pathways
xor01110  Biosynthesis of secondary metabolites
xor01120  Microbial metabolism in diverse environments
xor01130  Biosynthesis of antibiotics
xor01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xor00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XOC_4210
Enzymes [BR:xor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     XOC_4210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEQ98286
UniProt: G7TKE7
Position
complement(4361345..4362433)
Genome map
AA seq 362 aa AA seqDB search
MDGQGSAARISFRNDYSEGAHPRVLQALAQASAEQCAGYGTDRHTVRAVALIRNAVAQPQ
ADVHLLVGGTQTNLIAISAFLRPHQAVIAVEAGHIATHETGAIEATGHKVLTVPALHDKL
TPALLQPVLAVHSNEHMVQPRLVYMSNSTESGTIYTRAELEALSRFCRERDLLVYLDGAR
LGAALTANGNDLDLPTIAALTDAFYIGGTKNGALLGEALVVIHPVLQADLRYLIKQRGAL
LAKGMVLGAQFATLFEDGLFFELAAHANAMAQRLRAGLLAAGVEFTSDSPTNQQFVAVTA
QQAAQIARRYDFERWETRSDGRLVIRFATSWATTADAVDRLCADVAALLRDSTLRTISRT
QG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggacgggcagggcagcgccgcgcgcatcagctttcgcaacgactacagcgaaggcgcg
catccgcgtgtgctgcaggcattggcgcaggccagtgccgagcagtgcgccggctacggc
actgatcggcacacagtgcgtgcggttgcgttgatccgcaatgcagtcgcgcagccgcag
gccgacgtgcatctgctggtgggcggcacgcagaccaatctgatcgcaatcagcgcgttc
ttacgcccgcatcaggcggtcatcgcagtggaagcggggcatatcgccacgcacgaaacc
ggagctatcgaggcgactggccacaaggtgctcaccgtgccggcgctgcacgacaagctg
acgcctgcgctgcttcagcccgtgctcgctgtgcacagcaacgagcacatggtgcagccg
cgcctggtctacatgtccaacagcaccgaaagcggcaccatctatacgcgtgccgaactc
gaagcgttgtctcgcttctgtcgcgaacgcgatctgctggtgtatctcgacggcgcgcgg
ctgggcgcagcgctgactgccaacggcaacgatctggatctgccgaccattgccgcgctc
accgatgcgttctacatcggcggcaccaagaacggtgcgctgctcggcgaagccttggtc
gtgatccatccggtcctgcaggccgatctgcgatacctcatcaagcaacgcggcgcgctg
ttggccaagggcatggtgctcggcgcgcagttcgccaccttgttcgaagacggcttgttc
ttcgaactggccgcgcacgccaacgccatggcgcagcgcctgcgcgccggcctgctggcc
gcgggcgtggaattcaccagcgactcgccgaccaatcagcaattcgtcgccgtcaccgcg
cagcaggccgcccagatcgcacgccgctacgacttcgaacgctgggaaacgcgcagcgat
gggcggctggtcattcgcttcgcgacctcgtgggcgactacagctgacgctgtcgatcgt
ctgtgtgcggatgttgctgcgcttttgcgagattccacactcaggaccatttccaggaca
caaggatga

DBGET integrated database retrieval system