KEGG   Xanthomonas oryzae pv. oryzae PXO86: AZ54_05145Help
Entry
AZ54_05145        CDS       T03765                                 

Definition
(GenBank) diacylglycerol kinase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
xoy  Xanthomonas oryzae pv. oryzae PXO86
Pathway
xoy00670  One carbon pool by folate
xoy00790  Folate biosynthesis
xoy01100  Metabolic pathways
Module
xoy_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xoy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AZ54_05145
   00670 One carbon pool by folate
    AZ54_05145
Enzymes [BR:xoy01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     AZ54_05145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AJQ82090
Position
1056958..1057452
Genome map
AA seq 164 aa AA seqDB search
MKVILIVAFDRNNAIGRDNDLPWKLPDDLKRFKALTLGKPILMGRKTAQSLRRALPGRLN
LVLTRSGLVPFDGMQAVASVAQAVERAVQDGAQELCVIGGGEVYRLTMERADLLAVTEVD
TAVDDADTHFPPIDPAAWSPVRRQLHPADDRHAYAFSFVDYERR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgatcttgatcgtcgccttcgaccgcaacaacgccatcggccgtgataacgat
ctgccgtggaaactgcccgatgatctcaagcgcttcaaagcgctgacgctgggcaagccg
atcctgatggggcgcaagacggcgcagtctctcaggcgtgcgttgccggggcggttgaat
ctggtgctgacgcgttcggggctggtgccgttcgacggcatgcaggcggtggcatcggtg
gcgcaggcggtcgaacgcgccgtgcaagacggtgcgcaggagctgtgcgtgatcggtggc
ggggaggtatatcgcctgaccatggaacgtgccgatctgctggccgtgaccgaagtggac
acggcggtagacgatgccgacacgcattttccgccgatcgacccggcggcgtggtcgcct
gtgaggcgtcagttacatcctgccgacgatcggcacgcctatgcgttttcgttcgtggat
tacgaacgccgctga

DBGET integrated database retrieval system