KEGG   Xanthomonas oryzae pv. oryzae PXO86: AZ54_05825Help
Entry
AZ54_05825        CDS       T03765                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
xoy  Xanthomonas oryzae pv. oryzae PXO86
Pathway
xoy03010  Ribosome
Brite
KEGG Orthology (KO) [BR:xoy00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AZ54_05825
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:xoy03011]
    AZ54_05825
Ribosome [BR:xoy03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AZ54_05825
  Bacteria
    AZ54_05825
  Archaea
    AZ54_05825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AJQ82205
Position
1179015..1179350
Genome map
AA seq 111 aa AA seqDB search
MEAKAILRTARISPQKARLVADQVRGLSAERAVNLLKFSDKKAAHLIKKVVESAIANAEN
NQGADVDELKVKTIMVDEGPSLKRFMARAKGRGTRILKRTSHITVIVGAAK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgaaagcaatcctgcgcaccgcgcgcatctccccgcagaaggcccgcctggtc
gctgatcaggtgcgtggtttgtccgccgagcgtgcggtcaatttgctgaagttctcggac
aagaaggctgcacacctgatcaaaaaggtggtggagtcggctattgccaatgccgagaac
aatcagggcgcggatgtcgacgagctgaaggtcaagaccatcatggttgatgaaggtccg
tctctgaagcgtttcatggcgcgggcgaaaggccgcggtacccgcatcctcaagcgcacc
agtcacatcactgtgattgtcggcgccgccaagtaa

DBGET integrated database retrieval system