KEGG   Xanthomonas oryzae pv. oryzae PXO86: AZ54_15095Help
Entry
AZ54_15095        CDS       T03765                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xoy  Xanthomonas oryzae pv. oryzae PXO86
Pathway
xoy00071  Fatty acid degradation
xoy00072  Synthesis and degradation of ketone bodies
xoy00280  Valine, leucine and isoleucine degradation
xoy00310  Lysine degradation
xoy00362  Benzoate degradation
xoy00380  Tryptophan metabolism
xoy00620  Pyruvate metabolism
xoy00630  Glyoxylate and dicarboxylate metabolism
xoy00640  Propanoate metabolism
xoy00650  Butanoate metabolism
xoy00900  Terpenoid backbone biosynthesis
xoy01100  Metabolic pathways
xoy01110  Biosynthesis of secondary metabolites
xoy01120  Microbial metabolism in diverse environments
xoy01130  Biosynthesis of antibiotics
xoy01200  Carbon metabolism
xoy01212  Fatty acid metabolism
xoy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xoy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZ54_15095
   00630 Glyoxylate and dicarboxylate metabolism
    AZ54_15095
   00640 Propanoate metabolism
    AZ54_15095
   00650 Butanoate metabolism
    AZ54_15095
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AZ54_15095
   00072 Synthesis and degradation of ketone bodies
    AZ54_15095
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AZ54_15095
   00310 Lysine degradation
    AZ54_15095
   00380 Tryptophan metabolism
    AZ54_15095
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AZ54_15095
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AZ54_15095
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AZ54_15095
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xoy04147]
    AZ54_15095
Enzymes [BR:xoy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AZ54_15095
Exosome [BR:xoy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AZ54_15095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJQ83754
Position
3087973..3089148
Genome map
AA seq 391 aa AA seqDB search
MSDIVIVAAKRTAIGSFLGQFNGVPAPTLAAAAIQGALAQSGIAPADVSEVIVGCVLPAN
LGQAPARQAAIAAGIPTSTGATTVNKVCGSGMKAIMFGHDLIKAGSASIVVAGGMESMSN
APHLLPNSRTGNRYGNFQAVDHMAWDGLTNPYDGQAMGVFGEATAEKFGFSRADQDAFAI
ASVERAQAAQRSGAFADEIVPVTVATRKGKVVVDSDEQPGKSDVAKILTLKPAFKKDGSV
TAASSSSISDGAAITVLISADDARRRGVTPLARIVGHVTHSQEPEWFTTAPVAAIQSLVG
KIGWQLDEVDLFEINEAFAVVAMTPIKQLGIAHDKVNVHGGACALGHPIGASGARLVVTL
VNALRSRGGTRGIATLCIGGGEATAIAIELI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatcgtcatcgttgctgccaaacgcactgccatcggctcgttcctcggccaa
ttcaacggagtgccggcaccgacactcgccgccgctgccatccagggcgcgctcgcgcag
tcgggcatcgcgccggccgatgtctccgaagtcatcgtcggctgcgtgctgccggccaat
ctcggccaggcaccggcgcgtcaggccgcgatcgcggcaggcattcccacctcgaccggc
gctaccaccgtcaacaaggtctgcggctcgggcatgaaagcgatcatgttcggacacgac
ctgatcaaggccggctcggccagcatcgtggtggccggcggcatggagtcgatgagcaat
gcgccgcatctgctgcccaactcgcgcaccggcaatcgctacggcaatttccaggcggtc
gatcacatggcctgggacggtctgaccaacccgtacgacggccaggccatgggcgtattc
ggcgaggccactgccgaaaaattcggcttcagccgcgccgatcaggatgcattcgccatc
gcctcggtggaacgcgcacaggccgcgcagcgcagcggcgcatttgccgacgaaatcgtt
ccggtaacggtggccacgcgcaagggcaaggtcgtcgtcgacagcgatgagcagccgggc
aaatccgacgtggccaagattctgaccttgaagccggcgttcaagaaagacggcagcgtg
accgcggcaagctcctccagtatttccgatggcgcggcgatcacggtgctgataagcgcg
gacgacgcgcgacgccgcggcgtgacgccgctggcgcgcatcgtcggccatgtcacccat
tctcaggaacccgaatggttcaccaccgcaccggtcgctgcgatccaatcgctggttggc
aagatcggctggcaattggacgaggtcgatctattcgaaatcaacgaagcattcgccgtc
gtggcgatgacgccgatcaagcaactcggcatcgcgcacgacaaggtcaacgtacatggg
ggcgcctgtgcattgggtcatccgatcggtgcatcgggcgcgcgcttggtggtgacattg
gtgaacgcgttgcgcagccgcggaggcacgcgcggaatcgcgacgctgtgcatcggtggc
ggcgaagcgactgccatcgccatcgaattgatttaa

DBGET integrated database retrieval system