KEGG   Xanthomonas oryzae pv. oryzae PXO86: AZ54_20810Help
Entry
AZ54_20810        CDS       T03765                                 

Definition
(GenBank) succinyl-CoA:3-ketoacid-CoA transferase
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
xoy  Xanthomonas oryzae pv. oryzae PXO86
Pathway
xoy00072  Synthesis and degradation of ketone bodies
xoy00280  Valine, leucine and isoleucine degradation
xoy00650  Butanoate metabolism
xoy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xoy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AZ54_20810
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    AZ54_20810
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AZ54_20810
Enzymes [BR:xoy01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     AZ54_20810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans Mal_decarbox_Al
Motif
Other DBs
NCBI-ProteinID: AJQ84732
Position
complement(4305779..4306510)
Genome map
AA seq 243 aa AA seqDB search
MRNEVSGAASGKRYADAKTALDGVLADGQTLAVGGFGLCGIPEALIAALRDSGVAGLTVI
SNNAGVDGFGLGQLLATRQIRKMISSYVGENKEFERQYLAGELELEFNPQGTLAERLRAG
GAGIAAFYTATGYGTIVAEGKETREFDGKHYVLETALHADVALVKAWRADTAGNLVFRKT
ARNFNPACAMAGRVCIAEVEEIVELGVIDPDQVHLPGIYVDRLVLNATPEKRIEQRTVRE
GQQ
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaatgaagtaagcggtgcggcaagcggcaaacgctatgccgatgccaagacagcg
ctggatggggtactggccgatggtcagaccctggcagtgggcggctttgggttgtgtggc
attccggaggcactgattgcagccctacgcgacagtggggtcgccgggttgaccgtgatc
tccaacaacgctggcgtcgacggtttcgggcttggtcaattattggctacccgacagatc
cgcaagatgatttcgtcctatgtgggcgaaaacaaggaattcgaacgccaatacctggca
ggcgaacttgagctggagttcaatccgcaaggcaccctggccgagcgtttgcgcgcgggc
ggggcgggaattgctgcgttttatacggccaccggctacggcacgatcgtggccgagggc
aaggaaacgcgcgaattcgacggcaagcactacgtgctggaaaccgcactgcacgccgat
gtggcgctggtgaaggcatggcgcgccgataccgcgggcaacctggtgttccgcaagacg
gcacgcaatttcaatccggcctgcgccatggcgggtcgcgtgtgcattgccgaggtggag
gagatcgttgagctgggcgttatcgacccggatcaggtgcatctgcccggtatttacgtg
gaccgcctggtgctcaatgccacgccggaaaaacgcatcgaacagcgcaccgtgcgcgaa
ggacagcagtaa

DBGET integrated database retrieval system