KEGG   Xanthomonas oryzae pv. oryzicola CFBP7342: BE73_02945Help
Entry
BE73_02945        CDS       T03868                                 

Definition
(GenBank) amino acid lyase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
xoz  Xanthomonas oryzae pv. oryzicola CFBP7342
Pathway
xoz00260  Glycine, serine and threonine metabolism
xoz01100  Metabolic pathways
xoz01110  Biosynthesis of secondary metabolites
xoz01120  Microbial metabolism in diverse environments
xoz01130  Biosynthesis of antibiotics
xoz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xoz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BE73_02945
Enzymes [BR:xoz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BE73_02945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AJQ86191
UniProt: A0A0C5UVP3
Position
complement(600932..602020)
Genome map
AA seq 362 aa AA seqDB search
MDGQGSAARISFRNDYSEGAHPRVLQALAQASAEQCAGYGTDRHTVRAVALIRNAVAQPQ
ADVHLLVGGTQTNLIAISAFLRPHQAVIAVEAGHIATHETGAIEATGHKVLIVPALHDKL
TPALLQPVLAVHSNEHMVQPRLVYMSNSTESGTIYTRAELEALSRFCRERDLLVYLDGAR
LGAALTANGNDLDLPTIAALTDAFYIGGTKNGALLGEALVVIHPVLQADLRYLIKQRGAL
LAKGMVLGAQFATLFEDGLFFELAAHANAMAQRLRAGLLAAGVEFTSDSPTNQQFVAVTA
QQAAQIARRYDFERWETRSDGRLVIRFATSWATTADAVDRLCADVAALLRDSTLRAVSRT
QG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggacgggcagggcagcgccgcgcgcatcagctttcgcaacgactacagcgaaggcgcg
catccgcgtgtgctgcaggcattggcgcaggccagtgccgagcagtgcgccggctacggc
actgatcggcacacagtgcgtgcggttgcgttgatccgcaatgcagtcgcgcagccgcag
gccgacgtgcatctgctggtgggcggcacgcagaccaatctgatcgcaatcagcgcgttc
ttacgcccgcatcaggcggtcatcgcagtggaagcggggcatatcgccacgcacgaaacc
ggagctatcgaggcgactggccacaaggtgctcatcgtgccggcgctgcacgacaagctg
acgcctgcgctgcttcagcccgtgctcgctgtgcacagcaacgagcacatggtgcagccg
cgcctggtctacatgtccaacagcaccgaaagcggcaccatctatacgcgtgccgaactc
gaagcgttgtctcgcttctgtcgcgaacgcgatctgctggtgtatctcgacggcgcgcgg
ctgggcgcagcgctgactgccaacggcaacgatctggatctgccgaccattgccgcgctc
accgatgcgttctacatcggcggcaccaagaacggtgcgctgctcggcgaagccttggtc
gtgatccatccggtcctgcaggccgatctgcgatacctcatcaagcaacgcggcgcgctg
ttggccaagggcatggtgctcggcgcgcagttcgccaccttgttcgaagacggcttgttc
ttcgaactggccgcgcacgccaacgccatggcgcagcgcctgcgcgccggcctgctggcc
gcgggcgtggaattcaccagcgactcgccgaccaatcagcaattcgtcgccgtcaccgcg
cagcaggccgcccagatcgcacgccgctacgacttcgaacgctgggaaacgcgcagcgat
gggcggctggtcattcgcttcgcgacctcgtgggcgactacagctgacgctgtcgatcgt
ctgtgtgcggatgttgctgcgcttttgcgagattccacactcagggccgtttccaggaca
caaggatga

DBGET integrated database retrieval system