KEGG   Xanthomonas oryzae pv. oryzicola CFBP7342: BE73_09785Help
Entry
BE73_09785        CDS       T03868                                 

Definition
(GenBank) ornithine cyclodeaminase
  KO
K21721  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase [EC:1.5.1.51]
Organism
xoz  Xanthomonas oryzae pv. oryzicola CFBP7342
Pathway
xoz00998  Biosynthesis of secondary metabolites - other antibiotics
xoz00999  Biosynthesis of secondary metabolites - unclassified
xoz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xoz00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    BE73_09785
   00999 Biosynthesis of secondary metabolites - unclassified
    BE73_09785
Enzymes [BR:xoz01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.51  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase
     BE73_09785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCD_Mu_crystall Shikimate_DH 2-Hacid_dh_C 3HCDH_N F420_oxidored NmrA
Motif
Other DBs
NCBI-ProteinID: AJQ87345
UniProt: A0A0C5UJS1
Position
complement(2059440..2060462)
Genome map
AA seq 340 aa AA seqDB search
MNAIADQRFHVLGAECTRSVLEELGPGLIDTVEQIYRAHSRGRTVNPDSYFLRFPSSASN
RIIALPAALTSTEAPVSGIKWISSFPANHERGLPRASAVLVLNDAVTGFPFALLESAHIS
AYRTAASAVLGARALRGGKRRAGVIAVIGAGVIARSVMAMFAADDWKFDAVHVHDLHETA
ASGFSAELRELFETPANSVSLATALEADIVVFATTAGTPYVPADFVFRADQTLLNISLRD
LPPETILAANNVFDDVDHCLKAQTSPHLAEQRVGDRSFVTGTVVQLLDGECALDPSKASV
YSPFGMGILDVCIGREIFYKALAEGRAIEIPSFFAAEPRR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcgatcgccgaccaacgcttccatgtgctcggggcggagtgcacccgctcggtg
ctcgaggaactgggcccgggattgatcgataccgtcgaacagatctatcgcgcgcattcg
cgtggccgcacggtcaatcccgacagctacttcctgcggtttccgtcctccgcgtcgaac
cggatcattgccctgccggcggctctgacgagcacggaagcgccggtgtcgggcatcaag
tggatatccagctttcctgcgaaccacgagcgcgggttgccgcgagcgtccgcggtgctg
gtactgaacgatgcagtcacgggatttcccttcgcgttgcttgaatcggcgcacatcagc
gcctatcgcacggcggcatccgccgtgctgggggcacgagccctgagaggcggcaagcgt
cgcgcgggcgtgatcgccgtcatcggcgccggcgtcatcgccaggtcggtgatggcgatg
ttcgctgccgacgattggaagttcgatgctgttcacgtgcacgatctgcacgaaacggcc
gcctccggcttctcggcggagctgcgggagctgttcgagacgccggcgaactcggtcagc
ttggcgacggcgctcgaggccgacatcgtcgtattcgcgacgaccgccggaacaccctat
gtgcccgcggacttcgtcttccgggcggaccagacgctcctgaacatctcgctgcgcgat
cttccaccggagacgatcctcgccgccaacaatgtcttcgacgatgtcgaccactgcttg
aaggcgcagacttcgccgcatctggcggagcaacgcgttggagaccggtcgttcgtgacc
ggcacggttgtccaactgctggacggcgaatgtgcgctcgacccgagcaaggcgagcgtc
tattcaccattcggcatgggcattctcgacgtctgcatcgggcgcgaaatcttttacaag
gctctcgctgaaggccgcgccatcgagatcccgtcgttcttcgccgcggagcctcgacgc
tag

DBGET integrated database retrieval system