KEGG   Xanthomonas oryzae pv. oryzicola CFBP7342: BE73_14680Help
Entry
BE73_14680        CDS       T03868                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
xoz  Xanthomonas oryzae pv. oryzicola CFBP7342
Pathway
xoz00564  Glycerophospholipid metabolism
xoz01100  Metabolic pathways
xoz01110  Biosynthesis of secondary metabolites
Module
xoz_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:xoz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BE73_14680
Enzymes [BR:xoz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     BE73_14680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AJQ88156
UniProt: A0A0C5V1J7
Position
3066556..3067404
Genome map
AA seq 282 aa AA seqDB search
MSLVTSLTYVLPHRLLSSLARALAYSDRPATKQWLIDTVTRKFGVDLSEAQEPDPRTYPT
FNAFFTRALKPGARVPDVDPAALLMPADGRISQLGPIENGHIFQAKGQSFTAAELLGDAA
AAAPFNNGLFATVYLSPKDYHRVHMPWTGTLRETVHVPGRLFSVGPDAVRNVPRLFARNE
RLVCHFDTDFGPMASVMVGALLVSGVETVWSGVEIPRYGDRITRKDYRGKGIVLEKFAEM
ARFNYGSTVIVLLPPGVATLDGGLGAETSVRLGQALARRQLG
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcttgtcacgtccctgacctacgtgctgccgcaccggttgctgtcctcgctggcg
cgcgcgctggcctattccgatagacccgccaccaaacagtggttgatcgacacggtgaca
cgcaagttcggcgtggacctgagcgaagcgcaggagccggacccacgcacttatcccacc
ttcaatgcgttttttacccgcgccttgaagcccggcgcacgcgtgccggatgtcgacccg
gccgcgttgctgatgcccgccgacggccgcatcagccagctcggcccgatcgagaacggc
cacattttccaggccaaggggcagtcgttcaccgccgcagaattgctcggcgacgcagca
gccgcagcaccgttcaacaacggcctgttcgccaccgtgtacctgtcgcccaaggactac
caccgcgtgcatatgccgtggaccggcaccttgcgcgaaaccgtgcacgtgcccggccgg
ctgtttagtgtgggtccggacgcagtgcgcaacgtgccgcgcctgtttgcgcgcaacgag
cggctggtgtgccacttcgacaccgacttcggcccgatggcctcggtgatggtgggggcg
ctgctggtctccggcgtggaaacggtctggagcggcgtggagatcccgcgctatggcgac
cgcatcacgcgcaaggactaccgcggcaaagggatcgtgctggagaagtttgcggagatg
gcccggtttaactacggctcgaccgtgatcgtgttgctgccgccgggcgtggcgacgctt
gatggcggacttggcgccgaaacatcggttcggcttggccaggcactcgcacgtcgtcag
cttggctga

DBGET integrated database retrieval system