KEGG   Xanthomonas oryzae pv. oryzicola CFBP7342: BE73_19690Help
Entry
BE73_19690        CDS       T03868                                 

Definition
(GenBank) 23S rRNA methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
xoz  Xanthomonas oryzae pv. oryzicola CFBP7342
Brite
KEGG Orthology (KO) [BR:xoz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:xoz03009]
    BE73_19690
Enzymes [BR:xoz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     BE73_19690
Ribosome biogenesis [BR:xoz03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BE73_19690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ
Motif
Other DBs
NCBI-ProteinID: AJQ89015
UniProt: A0A0C5UP93
Position
4129243..4130286
Genome map
AA seq 347 aa AA seqDB search
MSGLLCYCRQGFEPELAAELSARAAFVGIAGYARTQRNDGYVLFVCEEAAQLAAKLQWRE
LIFARQKLVVIAELKGIDPKDRITPILAALEGQQRFGDLWVEHPDSDAGKPLAGLARSFG
NALRPALRKAGLLTDKPQPRQPRLHICFLDGDHALLAVADSADSAPWPLGIPRLKLLPEA
PSRSALKLDEALLTLLTPEEREALVTPGMRAADLGAAPGGWTWVLTRQHVHVTSVDNGPL
RAHVLETGLVEHLRADGFHWKPAQPLDWMVCDMVEQPRRVAERMATWVREGWCRNTIFNL
KLPMKKRWDETRLCLELFEQQAEKSLIVRAKQLYHDREEITVLAMRG
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcctgctgtgttactgccggcagggcttcgaacctgagctggccgccgaactg
agcgcgcgcgccgcattcgtcggcattgccggttatgcgcgcacccagcgcaacgacggc
tatgtgctgttcgtctgcgaggaggccgcacaacttgctgccaagctgcaatggcgcgag
ttgatcttcgcgcggcagaagctggtggtgatcgccgaactgaaaggcatcgaccccaag
gaccgcatcacgccgatcctggccgcgttggaggggcagcagcgtttcggcgatttgtgg
gtagaacaccccgattcggacgcaggcaagccattggcgggcctggcgcgcagcttcggc
aatgcgctgcgccctgccctgcgcaaggccggcctgctcaccgacaagccgcagccacgc
caaccgcgcttgcacatctgttttctcgatggagaccacgccttgcttgcggtggcagac
agcgccgatagcgcgccgtggccattgggcattccgcgcctgaagctgctgccggaagcg
ccgtcgcgctctgcgctcaagctcgacgaagccttgctgacgctgctcactcccgaagaa
cgcgaagcactggtcacacccggcatgcgcgcggccgatctgggcgctgcgcccggcggc
tggacctgggtactgacgcggcagcatgtgcatgtcaccagcgtcgacaacggtccgctg
cgcgcgcatgtactggaaaccgggctggtggagcatctgcgtgccgacggctttcactgg
aagcccgcgcaaccgctggactggatggtctgcgacatggtcgagcaaccgcgccgcgtc
gccgaacgcatggccacctgggtgcgcgaaggctggtgccgcaacaccatcttcaacctc
aagctgccgatgaaaaagcgctgggacgagacccgtctgtgcctggagctgttcgaacaa
caggcagaaaaatcattgatcgtgcgcgccaagcagctgtatcacgaccgcgaggagatc
acggtgctggcgatgcggggttga

DBGET integrated database retrieval system