KEGG   Xanthomonas oryzae pv. oryzicola CFBP7342: BE73_22005Help
Entry
BE73_22005        CDS       T03868                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
xoz  Xanthomonas oryzae pv. oryzicola CFBP7342
Pathway
xoz00010  Glycolysis / Gluconeogenesis
xoz00020  Citrate cycle (TCA cycle)
xoz00620  Pyruvate metabolism
xoz01100  Metabolic pathways
xoz01110  Biosynthesis of secondary metabolites
xoz01120  Microbial metabolism in diverse environments
xoz01130  Biosynthesis of antibiotics
xoz01200  Carbon metabolism
Module
xoz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:xoz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BE73_22005
   00020 Citrate cycle (TCA cycle)
    BE73_22005
   00620 Pyruvate metabolism
    BE73_22005
Enzymes [BR:xoz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BE73_22005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AJQ89394
UniProt: A0A0C5VGF6
Position
4623390..4624901
Genome map
AA seq 503 aa AA seqDB search
MSDNKNFHLPDLGEGLPDATIVEWFVKEGDTVRLDDPLVSMETAKAVVEVPSPFSGTVLK
LAGAAGDVIVTGSVLAQFALDASQPQRADGQDTGHSHGPVPTHSPTPSTGDSAAGPTARV
VASDNGGESADADAGDGSSDRDDAGTVVGAMQSSNAVQSEQAIAVGGVRAMPVVRALARK
LRVDLAQVRATGPDGTVTLADVKQAAAADTARPSPGAQGAPTSPARGSGGPVADSGRARG
VADGGRDRPEPATVLPPAGEGARRADEGSTARSPLSASGKPMRTQSPGTSVKGQPEQLKG
VRRNMARVMADAHTKVVPTTLNDDADLHAWHPGNDVTVRLVRGIVRACQAVPALNAWFDG
DALSRTLHNQIDIGIAVDTEEGLFVPALRNADMLDAHGIRESINRLRQQVENRSIAAPEL
SGYTISLSNFGMFAGRYATPVVVPPCVAIVAAGRARYQLTPVMGGVETHKVMPLSLTFDH
RAATGGEAARFLRALLDDLALAN
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaacaagaacttccacctgcccgacctgggcgaaggcctgcccgatgccacc
atcgtcgaatggttcgtcaaggagggcgacaccgtgcgcctggacgacccgctggtgtcg
atggaaaccgccaaggcggtggtcgaagtgccctcgccgttttccggcaccgtgctcaag
ctcgccggcgccgccggcgatgtgatcgtgaccggctcggtgctggcgcagttcgcgctg
gatgcctcgcagccgcaacgcgcagacgggcaagacaccggccattcgcatggcccggtg
ccgacgcactcacccacgccgagcaccggcgacagcgcggccggccccacggcgcgcgtg
gtggcctccgacaacggcggcgagagtgccgatgccgatgctggcgatggcagcagcgat
cgcgatgacgccggcaccgtggtcggcgcgatgcagagctccaacgccgtgcagagcgaa
caggccatcgcggtcggcggcgtgcgcgccatgccggtggtgcgcgcgctcgcacgcaag
ctgcgcgtggacctggcacaggtgcgtgccaccgggccggacggcacggtgacgctggct
gacgtaaagcaggccgcagccgcagacaccgcgcggccctcacccggcgcgcagggcgcg
ccgacctctcccgcacgcgggagcggtggaccggtcgctgacagtggcagggcccgcggg
gtcgctgacggtggcagagatcgaccggaaccggcgactgttctcccgcctgcgggagaa
ggtgcccgcagggcggatgagggcagcactgcccgctcgccgctgtcggccagcggcaag
ccgatgcgcacccaatcgcccggcaccagcgtcaagggccagccggaacagctcaagggc
gtgcgccgcaacatggcgcgggtgatggccgatgcgcatacaaaggtcgtgccgaccacg
ctcaacgacgatgccgacctgcacgcctggcaccccggcaacgatgtcaccgtgcgtttg
gtgcgcggcatcgtgcgcgcctgccaggcggtgcccgcactcaacgcatggttcgacggc
gacgccctcagccgcaccctgcacaaccagatcgatatcggcattgccgtggataccgaa
gaaggcctgttcgtgccggcgttgcgcaacgccgacatgctggacgcgcacggcatccgc
gaaagcatcaaccggctgcgtcagcaggtggaaaaccgcagcatcgccgcgcccgaattg
agcggctacaccatctcgctgtccaacttcggcatgttcgccgggcgctacgccacgccg
gtggtggtgccgccatgcgtggcgatcgtggccgccggccgtgcgcgctaccagctcacc
ccggtgatgggcggcgtggaaacccacaaggtgatgccgctgtcgttgaccttcgatcac
cgcgccgccaccggcggtgaagcagcgcgcttcctgcgcgcattgctggacgatctggcg
ttggccaactga

DBGET integrated database retrieval system