KEGG   Xanthomonas oryzae pv. oryzicola CFBP7342: BE73_22880Help
Entry
BE73_22880        CDS       T03868                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xoz  Xanthomonas oryzae pv. oryzicola CFBP7342
Pathway
xoz00071  Fatty acid degradation
xoz00072  Synthesis and degradation of ketone bodies
xoz00280  Valine, leucine and isoleucine degradation
xoz00310  Lysine degradation
xoz00362  Benzoate degradation
xoz00380  Tryptophan metabolism
xoz00620  Pyruvate metabolism
xoz00630  Glyoxylate and dicarboxylate metabolism
xoz00640  Propanoate metabolism
xoz00650  Butanoate metabolism
xoz00900  Terpenoid backbone biosynthesis
xoz01100  Metabolic pathways
xoz01110  Biosynthesis of secondary metabolites
xoz01120  Microbial metabolism in diverse environments
xoz01130  Biosynthesis of antibiotics
xoz01200  Carbon metabolism
xoz01212  Fatty acid metabolism
xoz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xoz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BE73_22880
   00630 Glyoxylate and dicarboxylate metabolism
    BE73_22880
   00640 Propanoate metabolism
    BE73_22880
   00650 Butanoate metabolism
    BE73_22880
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BE73_22880
   00072 Synthesis and degradation of ketone bodies
    BE73_22880
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BE73_22880
   00310 Lysine degradation
    BE73_22880
   00380 Tryptophan metabolism
    BE73_22880
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BE73_22880
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BE73_22880
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BE73_22880
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xoz04147]
    BE73_22880
Enzymes [BR:xoz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BE73_22880
Exosome [BR:xoz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BE73_22880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJQ89536
UniProt: A0A0C5V5I9
Position
complement(4802685..4803980)
Genome map
AA seq 431 aa AA seqDB search
MPGQPMPAARPVAILGGVRIPFCRQNTAYADVGNLGMSVRTLGALVERFGLHGQQLGEVA
MGAVIKHSSDWNLAREATLSSGLSPLTPGITLQRACGTSLDSVITIANKIALGQIDSGIG
GGSDTTSEVPIVYGKKLRARLLAANRVKANGDKLKTLLRGFKLGELKPEFPGVAEPRTGK
SMGDHCEDMAKEWNISRDSQDEWAVASHHKLAAAYERGFFDALIAPFRGVSRDNILRADT
SLEKLATLRPAFDKTSGRGTLTAANSTALTDGAAAVLLSSEAWALAHGHTPMAYLRDAQV
AAVDFVHGQGLLMAPTIAVPQMLARQGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCR
NRLGLDAPLGRIDPDKINPLGSSLATGHPFAATGARVVATAAKQLEERGGGRALISICTA
GGMGVVAIVER
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtcaaccgatgcccgcagcacgtcccgtcgccattttaggcggcgttcgtatc
ccgttttgccgtcagaacaccgcatacgcggatgtaggcaacctgggtatgtcggtgcgc
acgctgggcgcgctggtcgagcgcttcgggctgcatgggcagcaattgggcgaagtggcg
atgggcgcggtgatcaagcactcctcggactggaatctggcccgcgaggcgacgctgtcg
tcgggtctgtcgccgctgacgccgggcatcaccctgcagcgcgcctgcggcaccagcctg
gattcggtgattaccatcgccaacaagatcgcgctggggcagatcgattcgggcatcggc
ggcggttcggacaccacctccgaagtgccgatcgtctacggcaagaaactgcgcgcgcgg
ctgttggccgccaatcgtgtcaaggccaacggcgacaagctcaagacgctgttgcgcggc
ttcaagctgggtgagctcaaacccgaattccccggcgtggccgaaccgcgcaccggcaag
agcatgggcgaccactgcgaggacatggccaaggaatggaacatctcgcgcgattcgcag
gacgaatgggcggtggcctcgcaccacaagctggccgctgcgtatgagcgcggtttcttc
gatgcgctgatcgccccgttccgcggcgtctcgcgcgacaacatcctgcgcgccgacacc
tcgctggaaaaacttgccacgctgcgtcccgccttcgacaagacctccggccgcggcacg
ctcaccgcggccaattccactgcgctgaccgatggcgccgccgcggtgctgctgtccagc
gaagcctgggcgctggcgcatggtcacacaccgatggcctatctgcgcgatgcacaagtc
gcggcagtcgatttcgtgcatggccaaggcctgctgatggcgccgaccatcgcagtcccg
caaatgctggcacgacagggcctgaccctgcaggacttcgacatctacgaaatccacgaa
gccttcgctgcgcaggtgctgtgcacgctgcgcgcgtgggagagcgaggattactgccgc
aatcgcctgggcctggatgcgccgctgggccgcatcgaccccgacaagatcaacccgctg
ggttcctcgctagccaccggccacccgttcgcggccactggtgcgcgtgtggtggccacg
gccgccaagcagctggaagaacgcggcggcggccgtgcattgatttcgatctgcaccgcc
ggcggcatgggcgtggtggcgattgtcgagcgctga

DBGET integrated database retrieval system