KEGG   Xanthomonas perforans: BJD13_09645Help
Entry
BJD13_09645       CDS       T04778                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
xpe  Xanthomonas perforans
Pathway
xpe00450  Selenocompound metabolism
xpe00970  Aminoacyl-tRNA biosynthesis
xpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xpe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BJD13_09645
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BJD13_09645
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xpe01007]
    BJD13_09645
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xpe03016]
    BJD13_09645
Enzymes [BR:xpe01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BJD13_09645
Amino acid related enzymes [BR:xpe01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BJD13_09645
Transfer RNA biogenesis [BR:xpe03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BJD13_09645
 Prokaryotic type
   Other AARSs
    BJD13_09645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: APO99313
UniProt: A0A0G9A3M3
Position
1816515..1818599
Genome map
AA seq 694 aa AA seqDB search
MTRTALVTTALPYANGPLHLGHLVGYIQADIWVRARRLRGDKTWFVCADDTHGTPIMLAA
EKAGVTPEAFIANIQASHERDFAAFGVTFDHYDSTNSPVNRELTEAFYAKLEAAGHISRR
SVAQFYDTAKGMFLPDRYIKGICPNCGSPDQYGDNCEVCGATYAPTELKEPKSVISGATP
ELRDSEHFFFEVGHFDGFLREWLAGDVALPGVKAKLKEWLDAEGGLRAWDISRDAPYFGF
QIPGQPGKYFYVWLDAPIGYLCSFKTLCAQMGEDFASHLVAGTQTELHHFIGKDIVNFHG
LFWPAVLHGTGHRAPTRLHVNGYLTVDGAKMSKSRGTFVMARTFLDVGLEPEALRYYFAA
KSSGGVDDLDLNLGDFIARVNADLVGKFVNLASRCAGFIGKRFDGKLADALPDADQYDRF
VAALAPIREAYERNDAASAIRQTMALADEANKYIDDTKPWVIAKQDGADAQLQSVCTQGL
NLFRILVAALKPILPRTCAEAEAFLSAPMTSWEDVVRPLTAHTIQPYTALFTRIDPKLID
AMTDASKDTMAAPAAPAATTKPAPSRADAKPAAVANPESQSTNPGFIGMDDFAKLDLRIG
KVLVCEFVEGSDKLLRFELDAGELGKRQIFSGIRASYGEPDALVGRSVVFIANLAPRKMR
FGISEGMILSAGFDGGALALLDADSGAQPGMPVR
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcaccgcactcgtcactactgccctgccctacgccaacggcccgctgcatctt
ggccatctggtcggctacatccaggccgatatctgggtgcgcgcgcgccggttgcgcggc
gacaagacctggttcgtctgtgccgacgacacccatggcacgccgatcatgctggctgca
gagaaggccggggtgaccccggaagccttcatcgccaacatccaggccagccacgagcgc
gatttcgccgcgttcggcgtgaccttcgaccattacgattcgaccaattcgccggtcaat
cgcgagctcaccgaagccttctacgccaagctggaggccgccggccacatcagccgccgc
tcggtggcgcagttctacgatacggccaagggcatgttcctgccggaccgctacatcaag
ggcatctgccccaactgcggcagccccgaccagtacggcgacaactgcgaagtgtgcggc
gccacctatgcgcccaccgagctgaaggaaccgaagtcggtgatttcaggtgccaccccg
gaactgcgcgattcggaacacttcttcttcgaagtgggccacttcgacggcttcctgcgc
gagtggcttgccggcgatgtggcgctgcccggggtcaaggccaagctcaaggaatggctg
gatgccgagggcggcctgcgcgcctgggacatttcgcgcgatgcgccgtatttcggcttc
cagattcccggccagccgggcaagtatttctacgtgtggctggatgcgccgatcggctac
ctgtgcagcttcaagacgctgtgcgcgcagatgggcgaggacttcgcctcgcatctggtg
gccggcacccagaccgagttgcatcacttcatcggcaaggacatcgtcaatttccacggc
ctgttctggccggcggtgctgcacggcactggccaccgcgcgccgacccgcctgcacgtc
aatggctacctgacggtggacggggccaagatgtccaagtcgcgcggcaccttcgtcatg
gcgcggaccttcctggatgtgggccttgaaccggaagcgctgcgttactacttcgcggcc
aagtcttccggcggcgtggacgacctggacctcaacctgggcgatttcatcgcgcgggtg
aatgcggacctggtcggcaagttcgtcaacctggccagccgctgcgcgggcttcatcggc
aagcgcttcgacggcaagctggctgatgcgctacccgatgccgaccagtacgaccgcttc
gtcgccgcgctggcgccgatccgcgaggcctacgagcgcaacgacgcggccagcgcgatc
cgccagaccatggcgctggccgacgaggccaacaagtacatcgacgacaccaagccgtgg
gtgatcgccaagcaggacggcgccgatgcgcagctgcagtcggtctgcacgcagggcctg
aacctgttccgcatcctggtggccgcgctcaagccgatcctgccgcgcacctgcgccgaa
gccgaagccttcctgtcggcgccgatgaccagttgggaagacgtggtccgcccgctgaca
gcgcacacgatccagccctacaccgccctgtttacccgtatcgaccccaaactgatcgac
gccatgaccgacgcttccaaagacacgatggccgcacctgcggcaccggctgcaaccacc
aagcccgcaccgagcagggccgacgcaaagcctgccgccgttgcgaatcccgaatcccaa
agcaccaatcccggcttcatcggcatggatgactttgccaagctcgacctgcgcatcggc
aaggtgctggtgtgcgaattcgtggaaggctcggacaagttgctgcgtttcgaactggac
gccggtgaactgggcaagcggcagatcttctccggcattcgcgccagctacggcgagccg
gacgcactggtcggccgcagcgtggtgttcattgccaacctggccccacgcaagatgcgt
tttggcatcagcgaaggcatgatcttgtcggccggcttcgacggcggcgcgctggcgctg
ctggatgccgacagcggcgcacagccgggcatgccggtcaggtaa

DBGET integrated database retrieval system